DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5439 and RUBCN

DIOPT Version :9

Sequence 1:NP_609607.1 Gene:CG5439 / 34710 FlyBaseID:FBgn0032476 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_006713890.1 Gene:RUBCN / 9711 HGNCID:28991 Length:1012 Species:Homo sapiens


Alignment Length:409 Identity:78/409 - (19%)
Similarity:137/409 - (33%) Gaps:125/409 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 MRSQLAGSTFGQRREDIFRRLQESAHKISQKFSGKELAT-------------ERDESVQELCESL 69
            ||.:.||...|...|    ||.|.:.:...:..|....|             .:...::.||..:
Human     1 MRPEGAGMELGGGEE----RLPEESRREHWQLLGNLKTTVEGLVSTNSPNVWSKYGGLERLCRDM 61

  Fly    70 EELMSYGLRQSAGTSSFSAASFIQNMQEMVSGNAGGGSNNNDATFWEFCQ--THLTPHER---QR 129
            :.::.:||.:....                         .....:|:|.:  ..|:||..   ::
Human    62 QSILYHGLIRDQAC-------------------------RRQTDYWQFVKDIRWLSPHSALHVEK 101

  Fly   130 YMDLKQIWTNVGRGRA-------FIRATLNEKRLHSHVLTWLSDEEQLHRFYTPWSLLLND---E 184
            ::.:.:...:...|.:       :::.:|....|.:.:...|.|.:.:.:|||..:.||:|   .
Human   102 FISVHENDQSSADGASERAVAELWLQHSLQYHCLSAQLRPLLGDRQYIRKFYTDAAFLLSDAHVT 166

  Fly   185 AAKKLPEIVDSLSDVLFALNVDTTELNAPRRSTPSVAVKEE-----PIIFTTSP----------- 233
            |..:..|.|:..:..|.| .:|.: :.|.:..:|.:..|.:     |....|.|           
Human   167 AMLQCLEAVEQNNPRLLA-QIDAS-MFARKHESPLLVTKSQSLTALPSSTYTPPNSYAQHSYFGS 229

  Fly   234 -------VPVVGRQKRPGIAVERPIECVSSTEDLLG-ALKPIES------VEVQQILSKESIEQE 284
                   ||..|.::|            |::..|.| ..||.||      .|.|.|.:.......
Human   230 FSSLHQSVPNNGSERR------------STSFPLSGPPRKPQESRGHVSPAEDQTIQAPPVSVSA 282

  Fly   285 LAQPQEEVNLGPFDPIEPELEFLKTPLP--------DIGAHVGESELY------EDRSDTSSQWS 335
            ||:.      .|..|.|.....|.:|:.        |......|...|      :.|..|:|..|
Human   283 LARD------SPLTPNEMSSSTLTSPIEASWVSSQNDSPGDASEGPEYLAIGNLDPRGRTASCQS 341

  Fly   336 KS----SSSANCLANSQQQ 350
            .|    |||:|..::|..|
Human   342 HSSNAESSSSNLFSSSSSQ 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5439NP_609607.1 RUN 64..206 CDD:280855 25/156 (16%)
PX_RUN 404..520 CDD:132810
RUBCNXP_006713890.1 RUN 122..182 CDD:214736 13/59 (22%)
zf-RING_9 777..977 CDD:290612
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4381
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.