DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG5439 and SNX21

DIOPT Version :9

Sequence 1:	NP_609607.1	Gene:	CG5439 / 34710	FlyBaseID:	FBgn0032476	Length:	520	Species:	Drosophila melanogaster
Sequence 2:	NP_219489.1	Gene:	SNX21 / 90203	HGNCID:	16154	Length:	373	Species:	Homo sapiens

Alignment Length:	74	Identity:	20/74 - (27%)
Similarity:	40/74 - (54%)	Gaps:	5/74 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly   442 RRYSEFYKLHKSLLKT-HPVVSAVEFPPKKHFGNMNLVFVEERRQQLQIYLLNLVETLPQVEACK 505
            ||||:|.:||::|.:. ...::|:.||.|:...|.....:..|.:..:.:|.:| :.:|::   :
Human   170 RRYSDFERLHRNLQRQFRGPMAAISFPRKRLRRNFTAETIARRSRAFEQFLGHL-QAVPEL---R 230

  Fly   506 SKAELQKVF 514
            ...:||..|
Human   231 HAPDLQDFF 239

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG5439	NP_609607.1	RUN	64..206	CDD:280855
CG5439	NP_609607.1	PX_RUN	404..520	CDD:132810	20/74 (27%)
SNX21	NP_219489.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..107
		PX_SNX21	131..242	CDD:132834	20/74 (27%)
		TPR repeat	244..268	CDD:276809
		TPR_12	247..312	CDD:290160
		TPR repeat	281..312	CDD:276809
		TPR repeat	326..353	CDD:276809
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG2101
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900