DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5439 and SNX25

DIOPT Version :9

Sequence 1:NP_609607.1 Gene:CG5439 / 34710 FlyBaseID:FBgn0032476 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001364961.1 Gene:SNX25 / 83891 HGNCID:21883 Length:1037 Species:Homo sapiens


Alignment Length:641 Identity:114/641 - (17%)
Similarity:221/641 - (34%) Gaps:192/641 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 EDIFRRLQESAHKISQKFSGKELATERDESVQELCESLEELMSYGLRQSAGTSSFSAASFIQNMQ 96
            ||.:...::..|::|.....|.:.   ::.|:.|.....:|.:...|.......|...:.::|  
Human   201 EDFWEIARQLHHRLSHVDVVKVVC---NDVVRTLLTHFCDLKAANARHEEQPRPFVLHACLRN-- 260

  Fly    97 EMVSGNAGGGSNNNDATFWEFCQTHLT----PHERQRYMDLKQIWTNVGRGRAF---IRATLNEK 154
                       ::::..|.:.|...|.    |.:..:.:.|:.:...:...:..   :....|..
Human   261 -----------SDDEVRFLQTCSRVLVFCLLPSKDVQSLSLRIMLAEILTTKVLKPVVELLSNPD 314

  Fly   155 RLHSHVLTWLSDEEQLH----RFYT------PWSLLLND----EAAKKLPEIVDSLSDVLFALNV 205
            .::..:|..|:..||::    |.||      .:..|:|.    |..|:|.|.|.:.:.::...|.
Human   315 YINQMLLAQLAYREQMNEHHKRAYTYAPSYEDFIKLINSNSDVEFLKQLRESVQTSALLILEPNS 379

  Fly   206 DTTELNAPRRSTPSVAVKEEPII-----FTTSPVPVVGRQKRPGIAV------------------ 247
            ...:...|......|:.:.:.::     .|.|..|.:.|.|....|.                  
Human   380 ALAKSYPPLEKENRVSARYQIVVEIIQATTISSFPQLKRHKGKETAAMKADLLRARNMKRYINQL 444

  Fly   248 -------ERPIECV-----SSTEDLLGALKPIESVEVQQILSKESI------EQELAQPQEEVN- 293
                   |:.|..:     ...||  |||...|..:.|:||..|.|      .:......|.:: 
Human   445 TVAKKQCEKRIRILGGPAYDQQED--GALDEGEGPQSQKILQFEDILANTFYREHFGMYMERMDK 507

  Fly   294 ---LGPFDPIEPELEFLKTPLPDIGAHVGE----------------------------------- 320
               :..::.:|......|..:|.:   |||                                   
Human   508 RALISFWESVEHLKNANKNEIPQL---VGEIYQNFFVESKEISVEKSLYKEIQQCLVGNKGIEVF 569

  Fly   321 ----SELYEDRSD-------TSSQWSK------SSSSANCLANSQQ--------QAALEEHVNQL 360
                .::||...|       .|..:.|      ...::..::|..:        :.|:::..||:
Human   570 YKIQEDVYETLKDRYYPSFIVSDLYEKLLIKEEEKHASQMISNKDEMGPRDEAGEEAVDDGTNQI 634

  Fly   361 NERCALLETRVAEL------------SLQN-----RLLIRRLTKQF-----EETGID----PSSS 399
            ||:.:....::.||            |:||     :.::.:|..:.     |.|.:.    .:..
Human   635 NEQASFAVNKLRELNEKLEYKRQALNSIQNAPKPDKKIVSKLKDEIILIEKERTDLQLHMARTDW 699

  Fly   400 LCSNF-----LITIPHVKLAKTQRSGSHY-TYEVHITMRQ----RLEHWTFFRRYSEFYKLHKSL 454
            .|.|.     .||...|    |:.:|... .|.|.:::::    ..::||..||.|||..||:.|
Human   700 WCENLGMWKASITSGEV----TEENGEQLPCYFVMVSLQEVGGVETKNWTVPRRLSEFQNLHRKL 760

  Fly   455 LKTHPVVSAVEFP--PKKHFGNMNLVFVEERRQQLQIYLLNLVETLPQVEACKSKA 508
            .:..|.:..|:.|  .|..|.:::..|:|:.:.||..:|.||   |.....|:|:|
Human   761 SECVPSLKKVQLPSLSKLPFKSIDQKFMEKSKNQLNKFLQNL---LSDERLCQSEA 813

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5439NP_609607.1 RUN 64..206 CDD:280855 26/162 (16%)
PX_RUN 404..520 CDD:132810 33/117 (28%)
SNX25NP_001364961.1 PXA 166..321 CDD:396666 17/135 (13%)
235kDa-fam <331..>691 CDD:130673 58/364 (16%)
RGS_SNX25 488..596 CDD:188675 12/110 (11%)
PX_SNX25 699..821 CDD:132788 35/122 (29%)
Nexin_C 898..1004 CDD:400794
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.