DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5439 and SNX22

DIOPT Version :10

Sequence 1:NP_609607.1 Gene:CG5439 / 34710 FlyBaseID:FBgn0032476 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_079074.2 Gene:SNX22 / 79856 HGNCID:16315 Length:193 Species:Homo sapiens


Alignment Length:83 Identity:30/83 - (36%)
Similarity:44/83 - (53%) Gaps:9/83 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   421 SHYTYEVHITMRQRLEHWTFFRRYSEFYKLHKSLLKTHPVVSAVEFPPKKHFGNMNLVFVEERRQ 485
            ||..:.|.:....| .| |..||||||:.|||.:.|.:.|   .:||.|: ..|.....:|:|||
Human    23 SHMVFRVEVLCSGR-RH-TVPRRYSEFHALHKRIKKLYKV---PDFPSKR-LPNWRTRGLEQRRQ 81

  Fly   486 QLQIY---LLNLVETLPQ 500
            .|:.|   :|.|.:.:|:
Human    82 GLEAYIQGILYLNQEVPK 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5439NP_609607.1 RUN 37..206 CDD:459241
PX_RUN 404..520 CDD:132810 30/83 (36%)
SNX22NP_079074.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
PX_SNX22 2..116 CDD:132790 30/83 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.