Sequence 1: | NP_609607.1 | Gene: | CG5439 / 34710 | FlyBaseID: | FBgn0032476 | Length: | 520 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_083344.3 | Gene: | Snx16 / 74718 | MGIID: | 1921968 | Length: | 344 | Species: | Mus musculus |
Alignment Length: | 207 | Identity: | 48/207 - (23%) |
---|---|---|---|
Similarity: | 90/207 - (43%) | Gaps: | 32/207 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 306 FLKTPLPDIGAHVGESELYEDRSDTSSQWSKSSSSA--------NCLANSQQQAALEEHVNQLNE 362
Fly 363 RCA--LLETRV--AELSLQNRLLIRRLTKQFEETGID----PSSSLCSNFLITIPHVKLAKTQRS 419
Fly 420 GSHYTYEVHITMRQRLEHWTFFRRYSEFYKLHKSLLKTHPVVSAVEFPPKKHF-GNMNLVFVEER 483
Fly 484 RQQLQIYLLNLV 495 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5439 | NP_609607.1 | RUN | 64..206 | CDD:280855 | |
PX_RUN | 404..520 | CDD:132810 | 27/93 (29%) | ||
Snx16 | NP_083344.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..72 | 13/69 (19%) | |
PX_SNX16 | 105..214 | CDD:132809 | 29/103 (28%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG2101 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |