DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5439 and Snx16

DIOPT Version :9

Sequence 1:NP_609607.1 Gene:CG5439 / 34710 FlyBaseID:FBgn0032476 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_083344.3 Gene:Snx16 / 74718 MGIID:1921968 Length:344 Species:Mus musculus


Alignment Length:207 Identity:48/207 - (23%)
Similarity:90/207 - (43%) Gaps:32/207 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 FLKTPLPDIGAHVGESELYEDRSDTSSQWSKSSSSA--------NCLANSQQQAALEEHVNQLNE 362
            ::..|:| ||.  ..|....:|:..||.:...|:|:        :....|.:|..:::.::..:.
Mouse     5 YVPVPMP-IGN--SASSFTNNRNQRSSSFGSVSTSSTSSKGQLEDSAVGSLKQTNVQDQMDSASS 66

  Fly   363 RCA--LLETRV--AELSLQNRLLIRRLTKQFEETGID----PSSSLCSNFLITIPHVKLAKTQRS 419
            .|.  |:.|:.  .:.|::.....|...:|..| .::    ||:.....:.:.....|..     
Mouse    67 MCGSPLIRTKFTGTDSSIEYSARPREAEEQHPE-AVNWEDRPSTPTILGYEVMEERAKFT----- 125

  Fly   420 GSHYTYEVHITMRQRLEHWTFFRRYSEFYKLHKSLLKTHPVVSAVEFPPKKHF-GNMNLVFVEER 483
                .|:: :..:...|.|..||||::|.:|:..|.:..|.. .:..|||:.| .|.|..|:|:|
Mouse   126 ----VYKI-LVKKSPEESWVVFRRYTDFSRLNDKLKEMFPGF-RLALPPKRWFKDNYNAEFLEDR 184

  Fly   484 RQQLQIYLLNLV 495
            :..||.:|.|||
Mouse   185 QLGLQAFLQNLV 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5439NP_609607.1 RUN 64..206 CDD:280855
PX_RUN 404..520 CDD:132810 27/93 (29%)
Snx16NP_083344.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..72 13/69 (19%)
PX_SNX16 105..214 CDD:132809 29/103 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.