DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5439 and Rufy2

DIOPT Version :9

Sequence 1:NP_609607.1 Gene:CG5439 / 34710 FlyBaseID:FBgn0032476 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_038955024.1 Gene:Rufy2 / 690777 RGDID:1592188 Length:737 Species:Rattus norvegicus


Alignment Length:422 Identity:75/422 - (17%)
Similarity:142/422 - (33%) Gaps:145/422 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 DLKQIWTNVGRGRAFIRATLNEKRLHSHVLTWLSDEEQLHRFYTPWSLLLNDEAAKKLPEIVDSL 196
            ||..:.|.:||.||::|..|.:|::..::...:...|.|..||...:|::.:|.|          
  Rat   225 DLPGLKTPLGRARAWLRLALMQKKMADYLRCLIIQRELLSEFYEYHALMMEEEGA---------- 279

  Fly   197 SDVLFALNVDTTELNAPRRSTPSVAVKEEPIIFTTSPVPVVGRQKRPGIAVERPIECVSSTEDLL 261
              |:..|.|....::|      ::.||.|.:   .|.|.|:            ........|:.:
  Rat   280 --VIVGLLVGLNVIDA------NLCVKGEDL---DSQVGVI------------DFSMYLKNEEEI 321

  Fly   262 GALKPIESVEVQQILSKESIEQELAQPQEEVNLGPFDPIEPELEFLKTPLPDIGAHVGESELYED 326
            |..:  .:|::..||.:::..:||   ..::|                                 
  Rat   322 GNKE--RNVQIAAILDQKNYVEEL---NRQLN--------------------------------- 348

  Fly   327 RSDTSSQWSKSSSSANCLANSQQQAALEEHVNQLNERCALLETRVA-------ELSLQNRLLIRR 384
             |..||..|:..|             ||:...:|.|..|:.:..:.       :|..:|.|::.|
  Rat   349 -STVSSLHSRVDS-------------LEKSNTKLIEELAIAKNNIIKLQEENHQLRSENELILMR 399

  Fly   385 LTKQFEETGIDPSSSL------------------------------CSNFL---ITIPH-VKLA- 414
            ..:..|.|.:|..:.|                              ..|.|   :.:.| ::|| 
  Rat   400 TRQHLEVTKVDVETELQTYKHSRQGLDEMYDDARRQLRDESQLRQDVENELSVQVGMKHEIELAM 464

  Fly   415 KTQRSGSHYTYEVHITMRQRLEHWTF--FRRYSEFYKLHKSLLKTHPVVSAVEFPPKKHFGNMNL 477
            |......|...:..|.:||:||....  ...|.:.......|.:.:.:::.              
  Rat   465 KLLEKDIHEKQDTLIGLRQQLEEVKAINIEMYQKLQGSEDGLKEKNEIIAR-------------- 515

  Fly   478 VFVEERRQQLQIYLLNLVETLPQVEACKSKAE 509
              :||:..::...:..|.:.|.|.|..:.:||
  Rat   516 --LEEKTNKITTAMRQLEQRLQQAEKAQMEAE 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5439NP_609607.1 RUN 64..206 CDD:280855 19/73 (26%)
PX_RUN 404..520 CDD:132810 21/113 (19%)
Rufy2XP_038955024.1 RUN 176..297 CDD:397055 21/89 (24%)
Smc 312..>667 CDD:224117 48/302 (16%)
FYVE_like_SF 665..734 CDD:333710
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4381
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.