DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5439 and Rundc3b

DIOPT Version :9

Sequence 1:NP_609607.1 Gene:CG5439 / 34710 FlyBaseID:FBgn0032476 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_006236065.1 Gene:Rundc3b / 688590 RGDID:1587590 Length:452 Species:Rattus norvegicus


Alignment Length:519 Identity:104/519 - (20%)
Similarity:197/519 - (37%) Gaps:124/519 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LAGSTFGQRREDIFRRLQESAHKISQKFSGKELATERDESVQELCESLEELMSYGLRQSAGTSSF 86
            |:||..|.::                ..|.:..|.||...:.....|::.|:.....::...||.
  Rat     9 LSGSRGGGKK----------------SLSARNAAVERRNLITVCRFSVKTLIDRSCFETIDDSSP 57

  Fly    87 SAASFIQNMQEMVS----GNAGGGSNNNDATFWEFCQTHLTPHERQ---RYMDLKQIWTNVGRGR 144
            ...:|...:::::|    |........:..:||::.:.......:.   ...:::.:.::..:||
  Rat    58 EFNNFAAVLEQILSHRLKGQVTWFGYESPRSFWDYIRVACRKVSQNCICSIENMENVSSSRAKGR 122

  Fly   145 AFIRATLNEKRLHSHVLTWLSDEEQLHRFYTPWSLLLNDEAAKKLPEIVDSLSDVLFALN-VDTT 208
            |:||..|.||.|..::.|.|.|.:...|||...:::|.:||        :.|:.:|..|| :|. 
  Rat   123 AWIRVALMEKHLSEYISTALRDFKTTRRFYEEGAIVLGEEA--------NMLAGMLLGLNAIDF- 178

  Fly   209 ELNAPRRSTPSVAVKEEPIIFTTSPVPVVGRQKRPGIAVERPIECVSSTEDLLGALKPIESVEVQ 273
                      |..:|.|.:..|   .|.| ....|.:..|:..:.:||.|:           |::
  Rat   179 ----------SFCLKGEGLDGT---FPAV-IDYTPYLKFEQSSDSISSDEE-----------ELR 218

  Fly   274 QILSKESIEQELAQPQEEVNLGPFDPIEPELEFLKTPLPDIGAHVGESELYEDRSDTSSQWSKSS 338
            ...|.:|   |.:.|:   |:||             ||               ..|.:|.::|  
  Rat   219 TFGSSDS---EGSTPE---NVGP-------------PL---------------ILDENSWFNK-- 247

  Fly   339 SSANCLANSQQQAALEEHVNQLNERCALLETRVAELSLQNRLLIRR-----LTKQFEETGIDPSS 398
                |....|:.....|....|.|...|.|.:::|...||::|::|     |..:.|:..::...
  Rat   248 ----CKRVRQKYQLTLEQKGYLEELLRLRENQLSESVSQNKILLQRIEDSDLAHKLEKEQLEYII 308

  Fly   399 SLCSNFLITIPHVKLAKTQRSGSHYT--------YEVHITMRQRLEHWTFFRRYSE--FYKLHKS 453
            ....:.|..:.:..|...|...:|.|        .:|:......|    .:|::::  :.|.::|
  Rat   309 VELQDQLTVLKNNDLRSRQELTAHLTNQWPSPGALDVNAVALDTL----LYRKHNKQWYDKSYQS 369

  Fly   454 L--LKTHPVVSAVEFPP---KKHFGNM-NLVFVEERRQQLQIYLLNLVETLPQVEACKSKAELQ 511
            |  |.....:|.....|   ::..|.. :|.|:.|.::... .||.|..:|..|.:.||...|:
  Rat   370 LDQLSAEVSLSQASLDPGHSQEGDGKQDSLNFIGEGKEDTP-SLLGLCGSLTSVASYKSLTSLK 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5439NP_609607.1 RUN 64..206 CDD:280855 31/149 (21%)
PX_RUN 404..520 CDD:132810 26/124 (21%)
Rundc3bXP_006236065.1 RUN 61..184 CDD:280855 29/141 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4381
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.