Sequence 1: | NP_609607.1 | Gene: | CG5439 / 34710 | FlyBaseID: | FBgn0032476 | Length: | 520 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_071416.2 | Gene: | SNX16 / 64089 | HGNCID: | 14980 | Length: | 344 | Species: | Homo sapiens |
Alignment Length: | 235 | Identity: | 59/235 - (25%) |
---|---|---|---|
Similarity: | 88/235 - (37%) | Gaps: | 88/235 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 306 FLKTPLPDIGAHVGESELYEDRSDTSSQWSKSSSSANCLANSQQQAALEEHVNQLNERCALLETR 370
Fly 371 VAELSLQNRLLIRRLTKQFEETGI----DPSSSLCSNFLITIPHVKLAKTQRSGSHYT------- 424
Fly 425 -------------------YEVHITMRQRL--------------EHWTFFRRYSEFYKLHKSLLK 456
Fly 457 THPVVSAVEFPPKKHF-GNMNLVFVEERRQQLQIYLLNLV 495 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5439 | NP_609607.1 | RUN | 64..206 | CDD:280855 | |
PX_RUN | 404..520 | CDD:132810 | 36/133 (27%) | ||
SNX16 | NP_071416.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..66 | 19/96 (20%) | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 81..107 | 2/25 (8%) | |||
PX_SNX16 | 105..214 | CDD:132809 | 30/96 (31%) | ||
SMC_N | <231..>336 | CDD:330553 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG2101 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |