DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5439 and SNX14

DIOPT Version :9

Sequence 1:NP_609607.1 Gene:CG5439 / 34710 FlyBaseID:FBgn0032476 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001337461.1 Gene:SNX14 / 57231 HGNCID:14977 Length:967 Species:Homo sapiens


Alignment Length:489 Identity:97/489 - (19%)
Similarity:177/489 - (36%) Gaps:140/489 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 IRATLNEKRLHSHVLTWLSDEEQLHRFYTP--------WSLLLND--EAAKKLPEIVDSLSDV-- 199
            :...|..:|...|.|..|:  |.|..:..|        .:||:.:  ..:..||.: |.|:|.  
Human   251 LHVALRSRRDELHYLRKLT--ELLFPYILPPKATDCRSLTLLIREILSGSVFLPSL-DFLADPDT 312

  Fly   200 ---LFALNVDTTELNAPRRSTPSVAVKEEPIIFTTSP-VPVV-----GRQKRPGIAVERPIECVS 255
               |..:.:|.   :.|.::|       ||    .|| ||.:     .|.|:|.: ::..::.:.
Human   313 VNHLLIIFIDD---SPPEKAT-------EP----ASPLVPFLQKFAEPRNKKPSV-LKLELKQIR 362

  Fly   256 STEDLL----GALKPIESVEVQQI-LSKESIEQELAQPQ-------------------------- 289
            ..:|||    ..||...:|.|.|. |:.|.....:.:|:                          
Human   363 EQQDLLFRFMNFLKQEGAVHVLQFCLTVEEFNDRILRPELSNDEMLSLHEELQKIYKTYCLDESI 427

  Fly   290 ----------EEVNL---GP-------------FDPIEPELEFLKTPLPDIGAHVGE---SELYE 325
                      ||:..   ||             |:..|..|..|:.....:..|..|   ..|..
Human   428 DKIRFDPFIVEEIQRIAEGPYIDVVKLQTMRCLFEAYEHVLSLLENVFTPMFCHSDEYFRQLLRG 492

  Fly   326 DRSDT-SSQWSKSSSSANCLANSQQQAALEEHVNQLNERC-ALLETRVAELSLQNRLLIRRLTKQ 388
            ..|.| :|:.::.|.|.:...|:|::.. ...::::..:. .:.::...|.::.....:......
Human   493 AESPTRNSKLNRGSLSLDDFRNTQKRGE-SFGISRIGSKIKGVFKSTTMEGAMLPNYGVAEGEDD 556

  Fly   389 FEETGI------DPSSSL--------CSNFLITIPHVKLAKTQRSGSH--------YTYEVHITM 431
            |.|.||      .|..::        .:.:.|:||:|...:...|...        :..:|....
Human   557 FIEEGIVVMEDDSPVEAVSTPNTPRNLAAWKISIPYVDFFEDPSSERKEKKERIPVFCIDVERND 621

  Fly   432 RQRL----EHWTFFRRYSEFYKLHKSLLKTHPVVSAVEFPPKKHFGNMNLVFVEERRQQLQIYLL 492
            |:.:    |||:.:|||.|||.|...|.:.|......:.|.|:..|..|..|::.:|::.|.||.
Human   622 RRAVGHEPEHWSVYRRYLEFYVLESKLTEFHGAFPDAQLPSKRIIGPKNYEFLKSKREEFQEYLQ 686

  Fly   493 NLVETLPQVEACKSKAE-----------LQKVFP 515
            .|::. |::...:..|:           |.|:.|
Human   687 KLLQH-PELSNSQLLADFLSPNGGETQFLDKILP 719

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5439NP_609607.1 RUN 64..206 CDD:280855 16/73 (22%)
PX_RUN 404..520 CDD:132810 34/135 (25%)
SNX14NP_001337461.1 PXA 151..320 CDD:308031 16/71 (23%)
RGS_SNX14 361..487 CDD:188677 21/125 (17%)
PX_SNX14 585..707 CDD:132787 31/122 (25%)
Nexin_C 828..932 CDD:312222
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.