DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5439 and rufy2

DIOPT Version :9

Sequence 1:NP_609607.1 Gene:CG5439 / 34710 FlyBaseID:FBgn0032476 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001231848.1 Gene:rufy2 / 569096 ZFINID:ZDB-GENE-070424-66 Length:698 Species:Danio rerio


Alignment Length:404 Identity:69/404 - (17%)
Similarity:151/404 - (37%) Gaps:108/404 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 DLKQIWTNVGRGRAFIRATLNEKRLHSHVLTWLSDEEQLHRFYTPWSLLLNDEAAKKLPEIVDSL 196
            ||..:.|.:||.||::|..|.:|:|..::...::.::.|..||...:::|.:|.|          
Zfish   184 DLPGLKTPLGRARAWLRLALMQKKLADYLRLLITRKDILSEFYESSAVMLEEEGA---------- 238

  Fly   197 SDVLFALNVDTTELNAPRRSTPSVAVKEEPI----------IFTTSPVPVVGRQKRPGIAVERPI 251
              |:..|.|....::|      ::.||.|.:          ::..:.:.....::|.|     .|
Zfish   239 --VIVGLLVGLNVIDA------NLCVKGEDLDTQVGVIDFSMYLKNDIDDYRSEERNG-----QI 290

  Fly   252 ECVSSTEDLLGALKPIESVEVQQILSK-ESIEQELAQPQEEVNLGPFDPIEPELEFLKTPLPDIG 315
            ..:...::.:..|....:..||.:..: ||:|:..::..||:.:...:.|:.             
Zfish   291 AAILDQKNYVEELNRQLNSTVQGLQGRVESLEKNNSKLIEELAIAKNNIIKL------------- 342

  Fly   316 AHVGESELYEDRSDTS-------SQWSKSSSSANCLANSQQQA--ALEEHVN----QLNERCALL 367
                :.|.::.|::.|       .:.:.:....:|..::.:|:  .|:|..|    ||.|.|.|.
Zfish   343 ----QEENHQLRTENSVILMKAQQRLAVTEGDLSCELDTYKQSRQGLDEMYNEARRQLKEECQLR 403

  Fly   368 ETRVAELSLQNRLLIRRLTKQFEETGIDPSSSLCSNFLITIPHVKLAKTQRSGSHYTYEVHITMR 432
            :      .::|.|:::...||..|..:                    |......|...:..|.:|
Zfish   404 Q------DVENELVVQVSMKQEMEMAM--------------------KLLEKDIHEKQDTLIGLR 442

  Fly   433 QRLEHWTFF--RRYSEFYKLHKSLLKTHPVVSAVEFPPKKHFGNMNLVFVEERRQQLQIYLLNLV 495
            .:|:.....  ..|.:......|:.:.:.:::.                :||:..|:...:..|.
Zfish   443 HQLDEVKAINVEMYQKMQSSDDSMRQKNDMIAR----------------LEEKTNQITATMKQLE 491

  Fly   496 ETLPQVEACKSKAE 509
            :.|...|..::.||
Zfish   492 QRLQDAERERASAE 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5439NP_609607.1 RUN 64..206 CDD:280855 19/73 (26%)
PX_RUN 404..520 CDD:132810 15/108 (14%)
rufy2NP_001231848.1 RUN 135..258 CDD:280855 22/91 (24%)
Taxilin 300..625 CDD:286771 42/265 (16%)
FYVE_RUFY2 626..696 CDD:277298
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4381
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.