DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5439 and snx22

DIOPT Version :10

Sequence 1:NP_609607.1 Gene:CG5439 / 34710 FlyBaseID:FBgn0032476 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001038839.2 Gene:snx22 / 561624 ZFINID:ZDB-GENE-060825-154 Length:220 Species:Danio rerio


Alignment Length:124 Identity:30/124 - (24%)
Similarity:56/124 - (45%) Gaps:35/124 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   380 LLIRRLTKQFEETGIDPSSSLCSNFLITIPHVKLAKTQRSGSHYTYEVHITMRQRLEHWTFFRRY 444
            :.|..|.::.:|||                  ||.|        .:.|.|....| :|:. .||:
Zfish    13 VFIPSLMREVDETG------------------KLRK--------LFRVEILFNGR-KHFV-LRRH 49

  Fly   445 SEFYKLHKSLLKTHPVVSAVEFPPKKHFGNMNLVFVEERRQQLQIYLLNLV---ETLPQ 500
            .||..||:.:.|   ::...:||.|:: .::....:|:|||:|:.|:..::   :.:||
Zfish    50 GEFQTLHRKVKK---ILRVPDFPSKRN-QHLRTKPLEQRRQELEDYIQVILYQNDVVPQ 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5439NP_609607.1 RUN 37..206 CDD:459241
PX_RUN 404..520 CDD:132810 25/100 (25%)
snx22NP_001038839.2 PX_SNX22 11..121 CDD:132790 30/124 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.