DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5439 and snx14

DIOPT Version :10

Sequence 1:NP_609607.1 Gene:CG5439 / 34710 FlyBaseID:FBgn0032476 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_005160372.2 Gene:snx14 / 555970 ZFINID:ZDB-GENE-040724-144 Length:942 Species:Danio rerio


Alignment Length:151 Identity:37/151 - (24%)
Similarity:64/151 - (42%) Gaps:21/151 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   389 FEETGIDPSSSL--------CSNFLITIPHVKL----AKTQRSGSHYTYEVHITMRQRLEH---- 437
            ||:....|..::        .|.:.|:||:|..    .|.:|. ..:..:|....|:.:.|    
Zfish   542 FEDDSPGPMDAVGTPGTLRNLSAWTISIPYVDFYDDEVKKERI-PVFCIDVERNDRKNVGHETES 605

  Fly   438 WTFFRRYSEFYKLHKSLLKTHPVVSAVEFPPKKHFGNMNLVFVEERRQQLQIYLLNLVETLPQVE 502
            |:.:|:|.|||.|...|.:.|......:.|.|:..|..|..|:..:|.:.:.||..|:.. |::.
Zfish   606 WSVYRKYVEFYVLESKLTEFHGPFQDAQLPSKRIIGPKNYEFLSSKRGEFEEYLQKLLHH-PELS 669

  Fly   503 ACKSKAELQKVFPF---FRDR 520
            ..:..|:....|..   |||:
Zfish   670 NSQLLADFLSPFSMESQFRDK 690

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5439NP_609607.1 RUN 37..206 CDD:459241
PX_RUN 404..520 CDD:132810 32/126 (25%)
snx14XP_005160372.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.