DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5439 and snx14

DIOPT Version :9

Sequence 1:NP_609607.1 Gene:CG5439 / 34710 FlyBaseID:FBgn0032476 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_005160372.1 Gene:snx14 / 555970 ZFINID:ZDB-GENE-040724-144 Length:942 Species:Danio rerio


Alignment Length:151 Identity:37/151 - (24%)
Similarity:64/151 - (42%) Gaps:21/151 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   389 FEETGIDPSSSL--------CSNFLITIPHVKL----AKTQRSGSHYTYEVHITMRQRLEH---- 437
            ||:....|..::        .|.:.|:||:|..    .|.:|. ..:..:|....|:.:.|    
Zfish   542 FEDDSPGPMDAVGTPGTLRNLSAWTISIPYVDFYDDEVKKERI-PVFCIDVERNDRKNVGHETES 605

  Fly   438 WTFFRRYSEFYKLHKSLLKTHPVVSAVEFPPKKHFGNMNLVFVEERRQQLQIYLLNLVETLPQVE 502
            |:.:|:|.|||.|...|.:.|......:.|.|:..|..|..|:..:|.:.:.||..|:.. |::.
Zfish   606 WSVYRKYVEFYVLESKLTEFHGPFQDAQLPSKRIIGPKNYEFLSSKRGEFEEYLQKLLHH-PELS 669

  Fly   503 ACKSKAELQKVFPF---FRDR 520
            ..:..|:....|..   |||:
Zfish   670 NSQLLADFLSPFSMESQFRDK 690

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5439NP_609607.1 RUN 64..206 CDD:280855
PX_RUN 404..520 CDD:132810 32/126 (25%)
snx14XP_005160372.1 PXA 130..299 CDD:280373
RGS_SNX14 339..465 CDD:188677
PX_SNX14 563..681 CDD:132787 30/119 (25%)
Nexin_C 802..905 CDD:285792
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.