DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5439 and Rufy1

DIOPT Version :9

Sequence 1:NP_609607.1 Gene:CG5439 / 34710 FlyBaseID:FBgn0032476 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001094197.1 Gene:Rufy1 / 360521 RGDID:1305099 Length:711 Species:Rattus norvegicus


Alignment Length:610 Identity:124/610 - (20%)
Similarity:217/610 - (35%) Gaps:188/610 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NASSSMPTEAGFRSMRSQLAGSTFGQRREDIFRRLQESAH-----KISQKF---SGKELATERDE 60
            :..|::...||...     .|...|:|.....:.::|.|:     |:|.|.   |...|....|.
  Rat    84 SCGSALRAAAGLGD-----GGGGGGERAASKGQMMEERANLMHMMKLSIKVLLQSALSLGRSLDA 143

  Fly    61 S---VQELCESLEELMSYGLRQ-----SAGTSSFSAASFIQNMQEMVSGNAGGGSNNNDATFWEF 117
            .   :|:....:|..:.:||:.     ....|.|.....::.:....|..|....|         
  Rat   144 DHAPLQQFFVVMEHCLKHGLKVKKSFIGQNKSFFGPLELVEKLCPEASDIATSVRN--------- 199

  Fly   118 CQTHLTPHERQRYMDLKQIWTNVGRGRAFIRATLNEKRLHSHVLTWLSDEEQLHRFYTPWSLLLN 182
                           |.::.|.||||||::...|.:|:|..::...:.::..|..||.|.:|::.
  Rat   200 ---------------LPELKTAVGRGRAWLYLALMQKKLADYLKVLIDNKHLLSEFYEPEALMME 249

  Fly   183 DEAAKKLPEIVDSLSDVLFALNVDTTELNAPRRSTPSVAVKEEPIIFTTSPVPVV---------- 237
            :|..            |:..|.|....|:|      ::.:|.|.:   .|.|.|:          
  Rat   250 EEGM------------VIVGLLVGLNVLDA------NLCLKGEDL---DSQVGVIDFSLYLKDVQ 293

  Fly   238 ----GR----------QKRPGIAVERPIEC-VSSTEDLLGALKPIESVEVQQILSKE-----SIE 282
                ||          ||.....:.|.:.| |...:..:..|:...| ::|:.||..     |::
  Rat   294 DLDSGREHERITDVLDQKNYVEELNRHLSCTVGDLQTKIDGLEKTNS-KLQEELSAATDRICSLQ 357

  Fly   283 QELAQPQEEVNLGPFDPIEPELEFLKTPLPDIGAHVGESELYEDRSDTSSQWSKSSSSANCLANS 347
            :|..|.:|                             ::||..:||:.|.:.:|..:........
  Rat   358 EEQQQLRE-----------------------------QNELIRERSEKSVEITKQDTKVELETYK 393

  Fly   348 QQQAALEEHVN----QLNE----RCAL---LETRV---AELSLQNRLL----------IRRLTKQ 388
            |.:..|:|..:    ||.|    |..|   ||.::   .|:.:..:||          :..|.:|
  Rat   394 QTRQGLDEMYSDVWKQLKEEKKVRLELEKELELQIGMKTEMEIAMKLLEKDTHEKQDTLVALRQQ 458

  Fly   389 FEETGIDPSSSLCSNFLITIPHVKLAKTQRSGSHYTYEVHIT--------MRQRLEHWTFFRRYS 445
            .||.     .::.......:...:.:..|:..:..::|...|        |.:||:.....|:.:
  Rat   459 LEEV-----KAINLQMFHKVQSAESSLQQKDEAIASFEGKTTQVMSSMKQMEERLQQAERARQGA 518

  Fly   446 E--FYKLHKSLLKTHPVVSAVEFPPKKHFGNMN-----LVFVEERRQQLQIYLLN------LVET 497
            |  .|||.:.|...   |||::....:.....:     |...:|:||.||..|.:      |::|
  Rat   519 EERSYKLQQELSGR---VSALQLQLSQLRDQCSGLEKELKSEKEQRQTLQRELQHEKDTSCLLQT 580

  Fly   498 -LPQVEACK--------SKAELQKV 513
             |.|||..|        .||||:||
  Rat   581 ELQQVEGLKKELRELQDEKAELRKV 605

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5439NP_609607.1 RUN 64..206 CDD:280855 27/146 (18%)
PX_RUN 404..520 CDD:132810 35/140 (25%)
Rufy1NP_001094197.1 RUN 150..273 CDD:280855 30/164 (18%)
DUF3422 <443..588 CDD:295160 32/152 (21%)
FYVE_RUFY1 637..707 CDD:277297
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4381
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.