DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5439 and Rubicon

DIOPT Version :9

Sequence 1:NP_609607.1 Gene:CG5439 / 34710 FlyBaseID:FBgn0032476 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001259348.1 Gene:Rubicon / 31803 FlyBaseID:FBgn0030055 Length:827 Species:Drosophila melanogaster


Alignment Length:557 Identity:119/557 - (21%)
Similarity:181/557 - (32%) Gaps:190/557 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 QRREDIFRRLQESAHKISQKFSGKELATERDESVQE------LCESLEELMSYGLRQ----SAGT 83
            |:|  ||.|..:|...:||:          ||.:.:      .|::.....|:.||:    :..|
  Fly   235 QKR--IFLRRLKSLPNLSQE----------DEELDDRAAFRRRCQTFSSSRSHKLREDHLDAPST 287

  Fly    84 SSFSAASFIQNMQEMVSGNAGGGSNNNDATFWEFCQTHLTPHE-----RQRYMDLKQIWTNVG-- 141
            ||.|:....:.:|.:         |.:|...|    |..||.|     .::.....:..|:||  
  Fly   288 SSCSSHDSPRRIQLI---------NCDDIKIW----TDQTPQEVPEEVHEKLQQASKASTSVGGY 339

  Fly   142 RGRAFIRATLNEKRLHSHV---LTWLSDEEQL--------------HRFYTPWSLLLNDEAAKKL 189
            .|..|....|.....|..|   |....|...|              |..:...|:|  ||||...
  Fly   340 LGSFFGSPPLYTSWFHRGVGDDLNASGDGGMLDTFLPVNGRKLKKQHTLFEGVSML--DEAASST 402

  Fly   190 PEIVDSLSDVLFALNVDTTELNAPRRSTPSVAV--------KEEPIIFTTSPVPVVGRQKRPGIA 246
            ..|..:..|:..:....||...|    :.||::        ::....|..     :.||......
  Fly   403 ACISSAPWDIQGSAGDSTTSTTA----SSSVSITPGSDKMDQQSLASFLQ-----MSRQTHNNTQ 458

  Fly   247 VERPIECVSSTEDLLGALKPIESVEVQQILSKES--IEQELAQPQEEVNLGPF------------ 297
            :|:.......:|..:.|   ||.|:..:.|:..:  ....|::|    ||.|:            
  Fly   459 LEKENAHFRISEACITA---IEHVKWSRRLATPAGPTSHNLSEP----NLMPYAEQIPGGGMQNH 516

  Fly   298 --DPIEPEL--EFLKTPLPDIGAH----VGESEL-------------YEDRSDT--SSQWSKSSS 339
              :.:..:|  .|.:..||.:| |    |.|.|.             :|..|.|  :|.|     
  Fly   517 SAEAVGLQLISRFSEQQLPRLG-HLKWLVSEQEAPQQLLPLPTPKQDHEQASLTRGTSSW----- 575

  Fly   340 SANCLANSQQQAALEEH--------VNQLNERCALLETRVAELSLQNRLLIRRLTKQFEETGIDP 396
                 |..:||....||        :.:.|.|||....|||:...|:......|.|.        
  Fly   576 -----APPRQQIIFTEHPSESRSKVLQKQNHRCAGCGMRVAKHLQQHFRYCTYLGKY-------- 627

  Fly   397 SSSLCS----NFLITIPHVKLAKTQRSGSHYTYEVHITMRQRLEHWTFFRRY------SEFYKLH 451
               ||:    |.:..||    |:..||.....|.|.....:.:|....|..:      |:.|| |
  Fly   628 ---LCTGCHRNQISAIP----ARILRSWDFRCYPVCSFAYRLIEQMYAFPLFHVPDLNSQLYK-H 684

  Fly   452 KSLLKTHPVVSAVEFPPKKHFGNMNLVFVEERRQQLQ 488
            |.|.|                       ..:||.|||
  Fly   685 KELAK-----------------------ARKRRLQLQ 698

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5439NP_609607.1 RUN 64..206 CDD:280855 36/175 (21%)
PX_RUN 404..520 CDD:132810 21/91 (23%)
RubiconNP_001259348.1 zf-RING_9 619..824 CDD:290612 26/119 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4381
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.