DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5439 and snz

DIOPT Version :9

Sequence 1:NP_609607.1 Gene:CG5439 / 34710 FlyBaseID:FBgn0032476 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001284993.1 Gene:snz / 31704 FlyBaseID:FBgn0029976 Length:1117 Species:Drosophila melanogaster


Alignment Length:608 Identity:107/608 - (17%)
Similarity:207/608 - (34%) Gaps:206/608 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RSMRSQLAGSTFGQRREDIFRRLQESAHKISQKFSGKELATERDESVQEL--CESLEELM----- 73
            :::.::||.:...:|..:.....::....|:...:.:||:..|...|.:|  ..:::.|.     
  Fly   300 QNIETRLAAAAMSKRSYEYAASFEDFLKIINNSGNLEELSLIRKSIVNDLMHATTMQNLQRAKGL 364

  Fly    74 -----SYGLRQSAGTSSFSAASFIQNMQEMVSGNA----------GGGSNNNDATFWEFCQTHLT 123
                 .:.|.:|..|::.....:::.: .|..|..          |..|::.|.|..|...|.: 
  Fly   365 DPDHEDHSLSKSELTAAVRLKRYVRQL-TMAKGECEKNLAKFGWNGNYSSDIDLTLVEILNTAV- 427

  Fly   124 PHERQRYMDLKQIWTNVGRGRAFIRATLNEKRLHSHVLTWLSDEEQLHR------------FYT- 175
                               ||.:....|...:..:.:..:|:.||..|.            ||| 
  Fly   428 -------------------GRRYFTLFLEPLKASALIGFYLAVEEIKHAHKSASHQLGTEIFYTY 473

  Fly   176 ---PWSLLLNDEAAKKLPE---IVDSLSDVLFALNVDTTELNAPRRSTPSV------AVKE---- 224
               |.|.:..|:..:||.|   :.|:..|:.:.:..:.......:...|.|      .:||    
  Fly   474 IRVPKSEIQIDKHERKLIETFLLGDAEPDIFYDIQRNVLRTLEEKYYPPFVLSDQYRQLKEALDS 538

  Fly   225 ----EPIIFTTSPVPVVGRQKRPGIAVERPIECVSSTEDLLG--------------ALKPIESVE 271
                :|.:....   .:|..:.| :|.|:|    .:.:.|.|              |.:.:|  :
  Fly   539 NEIADPTLLMCH---TIGDVQEP-LADEQP----GAADGLNGGAGGAIDVAAHTSYARRKLE--Q 593

  Fly   272 VQQILSKESIEQEL------AQPQEEVNLGPFDPIEPELEFLKTPLPDIGAHVGESELYEDRSDT 330
            :|:.:.|::  |.|      .:|:.:|    ...:|.|:|:||:......||:       .|:|.
  Fly   594 IQERIDKKN--QALDALKYSVKPESKV----LTILEKEMEWLKSEKRQTEAHL-------RRTDA 645

  Fly   331 SSQWSKSSSSANCLANSQQQAALEEHVNQLNERCALLETRVAELSLQNRLLIRRLTKQFEETGID 395
               |:                   ||:.:.......:|....:.|||..:|:.  ..:.....:.
  Fly   646 ---WT-------------------EHLGKWKATIQSVEVSDEKESLQFMILVH--VDEDINAPVQ 686

  Fly   396 PSSSLCSNFLITIPHVKLAKTQRSGSHYTYEVHITMRQR----LEHWTFFRRYSEFYKLHKSLLK 456
            |:||               |...||       |..:|:|    ...|...|..::.::|.:.|..
  Fly   687 PTSS---------------KNGDSG-------HANLRKRPSGISSGWVVMRSLNQVHELQRKLRH 729

  Fly   457 THPVVSAVEFPPKKHFGNMNLVFV-------EERRQQLQIYL--------LN------------- 493
            ....:.|::.|.     |....|:       |:.:.|:|.:|        ||             
  Fly   730 VSSNLKAIDLPT-----NFKFFFLKTDRHGQEKAKSQIQKFLNFILEDDHLNGSEAIYTFLSPSS 789

  Fly   494 --LVETLPQVEACKSKAELQKVF 514
              |.::||..:  |||..|..:|
  Fly   790 DHLKQSLPSPK--KSKFSLSTLF 810

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5439NP_609607.1 RUN 64..206 CDD:280855 31/182 (17%)
PX_RUN 404..520 CDD:132810 28/145 (19%)
snzNP_001284993.1 PXA 142..299 CDD:280373
RGS_SNX25 422..531 CDD:188675 21/128 (16%)
PX_SNX25 645..788 CDD:132788 31/193 (16%)
Nexin_C 882..987 CDD:285792
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.