DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5439 and Plekhm2

DIOPT Version :9

Sequence 1:NP_609607.1 Gene:CG5439 / 34710 FlyBaseID:FBgn0032476 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001178696.1 Gene:Plekhm2 / 313667 RGDID:1307005 Length:1031 Species:Rattus norvegicus


Alignment Length:396 Identity:83/396 - (20%)
Similarity:146/396 - (36%) Gaps:86/396 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 REDIFRRLQESAHKISQKFSGKELAT----ERDESVQELCESLEELMSYGLRQSAGTSSFSAASF 91
            ::.|...:..|..|:...|:..|..|    ..|:.:|.|||.|:..:.|||              
  Rat     7 KDRILENISLSVKKLQSYFAACEDETPAIRNHDKVLQRLCEHLDHALLYGL-------------- 57

  Fly    92 IQNMQEMVSGNAGGGSNNNDATFWEFCQTHLTPHERQRYMD-LKQIWTNVGRGRAFIRATLNEKR 155
                |::.||            :| ....|.|..|..|.:: |:.:.||:||.||::...|||..
  Rat    58 ----QDLSSG------------YW-VVVVHFTRREAIRQIEVLQHVATNLGRSRAWLYLALNENS 105

  Fly   156 LHSHVLTWLSDEEQLHRFYTPWSLLLNDEAAKKLPEIVDSLSDVLFALNVDTTELN----APRRS 216
            |.|::..:..:...|.::|...:|:.:.:.......:|..|..:.|.|::|...|:    .|...
  Rat   106 LESYLRLFQENLGLLQKYYVRNALVCSHDHLTLFLTLVSGLEFIRFDLDLDAPYLDLAPYMPDYY 170

  Fly   217 TPSVAVKEEPIIFTTSPVPVVGRQKRPGIAVERPIECVSSTEDLLGALKPIESVEVQQILSKESI 281
            .|...:..|                      :|....|..::.|  :|....||....:   |..
  Rat   171 KPQYLLDFE----------------------DRLPSSVHGSDSL--SLNSFNSVTSTNL---EWD 208

  Fly   282 EQELAQPQEEVNLG---PFDPIEPELEFLKTPLPDI--GAHVGESELYEDRSDTSS--------- 332
            :..:|...|:.:.|   |..|..|..::....|.|.  |.....|:|...::.|.|         
  Rat   209 DSAIAPSSEDYDFGDVFPAVPSVPSTDWEDGDLTDTISGPRSTASDLTSSKASTKSPTQRHNPFN 273

  Fly   333 -QWSKSSSSANCLANSQQQAALEEHVNQLNERCALLETRVAELSLQNRLLIRRLTKQFEETGIDP 396
             :.::|:||.....::..|...|.......:.|..||  |..::.:.::..::.||..||.  .|
  Rat   274 EEQAESASSETTPVHTTSQEKEEAQAPDQPDACTELE--VIRVTKKKKIGKKKKTKLDEEA--SP 334

  Fly   397 SSSLCS 402
            ....||
  Rat   335 LHPNCS 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5439NP_609607.1 RUN 64..206 CDD:280855 34/142 (24%)
PX_RUN 404..520 CDD:132810
Plekhm2NP_001178696.1 RUN 93..156 CDD:214736 14/62 (23%)
PH 784..885 CDD:278594
PH_SKIP 785..887 CDD:270119
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4381
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.