DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5439 and Pxk

DIOPT Version :10

Sequence 1:NP_609607.1 Gene:CG5439 / 34710 FlyBaseID:FBgn0032476 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_063130435.1 Gene:Pxk / 306203 RGDID:727819 Length:582 Species:Rattus norvegicus


Alignment Length:129 Identity:41/129 - (31%)
Similarity:60/129 - (46%) Gaps:21/129 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   407 TIPHVKLAKTQRS-GSHYTYEVHITMRQRLEH-WTFFRRYSEFYKLHKSLLKTHPVVSAVEFPPK 469
            |:|.....:..:| .||..|.:.:......|: |...||||:|..|:.||..|.   .::..|||
  Rat    17 TVPLTAAVEASQSLQSHTEYIIRVQRGISAENSWQIVRRYSDFDLLNNSLQITG---LSLPLPPK 78

  Fly   470 KHFGNMNLVFVEERRQQLQIYLLNLV---ETLPQVEACK------------SKAELQKVFPFFR 518
            |..|||:..|:.||::.||.| ||::   ..|...|..|            ::..||:|..|||
  Rat    79 KLIGNMDREFIAERQKGLQNY-LNVIMANHVLSNCELLKKFLDPNNYSANYTEIALQQVSMFFR 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5439NP_609607.1 RUN 37..206 CDD:459241
PX_RUN 404..520 CDD:132810 41/129 (32%)
PxkXP_063130435.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.