DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5439 and Rundc3a

DIOPT Version :9

Sequence 1:NP_609607.1 Gene:CG5439 / 34710 FlyBaseID:FBgn0032476 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_942053.2 Gene:Rundc3a / 303569 RGDID:735057 Length:454 Species:Rattus norvegicus


Alignment Length:452 Identity:97/452 - (21%)
Similarity:166/452 - (36%) Gaps:123/452 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 SQKFSGKELATERDESVQELCESLEELMSYGLRQSAGTSSFSAASFIQNMQEMVS---------G 101
            |:|.|.:.:..||...:.....|::.|:.....:....||....:|...:::::|         |
  Rat    16 SKKASSRNVIVERRNLITVCRFSVKTLLEKYTAEPIDDSSEEFVNFAAILEQILSHRFKACAPAG 80

  Fly   102 NAGGGSNNNDATFWEF-----------CQTHLTPHERQRYMDLKQIWTNVGRGRAFIRATLNEKR 155
            .....|::....||::           |.:.:.        :::.|.|...:|||:||..|.|||
  Rat    81 PVSWFSSDGQRGFWDYIRLACSKVPNNCVSSIE--------NMENISTARAKGRAWIRVALMEKR 137

  Fly   156 LHSHVLTWLSDEEQLHRFYTPWSLLLNDEAA------------------------KKLPEIVDSL 196
            :..::.|.|.|.....|||...:::|.:||.                        .|.|.::|..
  Rat   138 MSEYITTALRDNRTTRRFYDSGAIMLREEATVLTGMLIGLSAIDFSFCLKGEVLDGKTPVVIDYT 202

  Fly   197 SDVLFALN----VDTTELNAPRRSTPSVAVKEEPIIFTTSPVPVVGRQK---RPGIAVERPIECV 254
            ..:.|..:    .|..|.::...||......|.|.:      |:|..:.   .....:|:....|
  Rat   203 PYLKFTQSYDYLTDEEERHSAESSTSEDNSPEHPYL------PLVTDEDSWYNKWHKMEQKFRIV 261

  Fly   255 SSTEDLLGAL-----KPIESVEVQQILSKESIEQELAQPQEEVNLGPFDPIEPELE----FLKTP 310
            .:.:..|..|     ..::.:|.:....:..:|:..||.|.|         :.|||    .|:..
  Rat   262 YAQKGYLEELVRLRESQLKDLEAENRRLQLQLEEAAAQNQRE---------KRELEGVILELQEQ 317

  Fly   311 LPD----------IGAHV----GESELYEDRSDTSSQWSKSSSSANCLANSQQQAALEEHVNQLN 361
            |||          .|.|.    |..||   .:...:||...|:.      |:.:.|..   ::|.
  Rat   318 LPDPPPPPRTGLIPGDHAPLAQGSKEL---TTALVNQWPSLSTL------SRPEGASN---SKLF 370

  Fly   362 ERCALLETR--VAELSLQNRLLIRRL--TKQFEE----TGIDPSSS---LCSNFLITIPHVK 412
            .|.:.:.|.  .||.||.:.  .:||  .|:.||    .|.||:.|   ||.: |.:||..|
  Rat   371 RRHSFMSTEPLSAEASLSSD--SQRLGEGKRDEEPWGPIGKDPTPSMLGLCGS-LASIPSCK 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5439NP_609607.1 RUN 64..206 CDD:280855 35/189 (19%)
PX_RUN 404..520 CDD:132810 4/9 (44%)
Rundc3aNP_942053.2 RUN 60..186 CDD:397055 27/133 (20%)
UPF0242 <238..>318 CDD:399636 16/94 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4381
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.