DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5439 and Snx14

DIOPT Version :9

Sequence 1:NP_609607.1 Gene:CG5439 / 34710 FlyBaseID:FBgn0032476 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001346887.2 Gene:Snx14 / 244962 MGIID:2155664 Length:946 Species:Mus musculus


Alignment Length:396 Identity:81/396 - (20%)
Similarity:128/396 - (32%) Gaps:128/396 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 LSDEEQLHRFYTPWSLLLNDEAAKKL---PEIVDSLSDVLFALNVDTTELNAPR----------- 214
            ||..|:|.:.|..:.|   ||:..|:   |.||:.:..:.....:|..:|...|           
Mouse   387 LSLHEELQKIYKTYCL---DESIDKIRFDPFIVEEIQRIAEGPYIDVVKLQTMRCLFEAYEHVLS 448

  Fly   215 ----RSTPSVAVKEEPIIFTTSPVPVVGRQKRPGIAVERPIECVS------STEDLLGALKPIES 269
                ..||.....:|..           ||...|  .|.|.....      |.:|.....|..||
Mouse   449 LLENVFTPMFCHSDEYF-----------RQLLRG--AESPTRNSKFNRGSLSLDDFRSTQKRGES 500

  Fly   270 VEVQQILSKESIEQELAQPQEEVNLGPFDPIEPELEFLKTPLPDIGAHVGESELYEDRSDTSSQW 334
            ..:.:|.||..              |.|.....|    ...||:.|...||.:.           
Mouse   501 FGISRIGSKIK--------------GVFKSTTME----GAVLPNYGVAEGEDDF----------- 536

  Fly   335 SKSSSSANCLANSQQQAALEEHVNQLNERCALLETRVAELSLQN---RLLIRRLTKQFEETGIDP 396
                              :||.:..:.:     ::.|..:|..|   .|...:::..:.:...||
Mouse   537 ------------------IEEGIVVMED-----DSPVEAVSTPNTPRNLAAWKISIPYVDFFEDP 578

  Fly   397 SSSLCSN------FLITIPHVKLAKTQRSGSHYTYEVHITMRQRLEHWTFFRRYSEFYKLHKSLL 455
            ||.....      |.|.:..    ..:|:..|           ..|||:.:|||.|||.|...|.
Mouse   579 SSERKEKKERIPVFCIDVER----NDRRAVGH-----------EPEHWSVYRRYLEFYVLESKLT 628

  Fly   456 KTHPVVSAVEFPPKKHFGNMNLVFVEERRQQLQIYLLNLVETLPQVEACKSKAE----------- 509
            :.|......:.|.|:..|..|..|::.:|::.|.||..||:. |::...:..|:           
Mouse   629 EFHGTFPDAQLPSKRIIGPKNYEFLKSKREEFQEYLQKLVQH-PELSNSQLLADFLSPNGGETQF 692

  Fly   510 LQKVFP 515
            |.|:.|
Mouse   693 LDKILP 698

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5439NP_609607.1 RUN 64..206 CDD:280855 12/44 (27%)
PX_RUN 404..520 CDD:132810 32/123 (26%)
Snx14NP_001346887.2 PXA 130..299 CDD:308031
RGS_SNX14 340..466 CDD:188677 18/92 (20%)
PX_SNX14 564..686 CDD:132787 33/137 (24%)
Nexin_C 807..911 CDD:337134
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.