powered by:
Protein Alignment CG5439 and SGK3
DIOPT Version :9
Sequence 1: | NP_609607.1 |
Gene: | CG5439 / 34710 |
FlyBaseID: | FBgn0032476 |
Length: | 520 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001028750.1 |
Gene: | SGK3 / 23678 |
HGNCID: | 10812 |
Length: | 496 |
Species: | Homo sapiens |
Alignment Length: | 72 |
Identity: | 27/72 - (37%) |
Similarity: | 45/72 - (62%) |
Gaps: | 4/72 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 425 YEVHITMRQRLEHWTFFRRYSEFYKLHKSLLKTHPVVSAVEFPPKKHFG-NMNLVFVEERRQQLQ 488
|:|.:::.: ..|..||||:||.||:.:|.|..|.: |::.|.|:.|| |.:..|:::||..|.
Human 34 YKVLVSVGR--SEWFVFRRYAEFDKLYNTLKKQFPAM-ALKIPAKRIFGDNFDPDFIKQRRAGLN 95
Fly 489 IYLLNLV 495
.::.|||
Human 96 EFIQNLV 102
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG2101 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.