DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5439 and nish-1

DIOPT Version :9

Sequence 1:NP_609607.1 Gene:CG5439 / 34710 FlyBaseID:FBgn0032476 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_502016.2 Gene:nish-1 / 177981 WormBaseID:WBGene00008750 Length:497 Species:Caenorhabditis elegans


Alignment Length:134 Identity:40/134 - (29%)
Similarity:61/134 - (45%) Gaps:32/134 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   397 SSSLCSNFLITIPHVKLAKTQRSGSHYTYEVHITMRQRLEHWTFFRRYSEF--YKLHKSLLKTHP 459
            |..:.:||...|.:.::..   .|.:..|.:.||:....  ||..||||:|  |.:|:.|.:...
 Worm    10 SPQMDANFNAKILNFRMID---EGKYTVYRIQITVDTYT--WTVERRYSDFDAYDVHRFLDRKKS 69

  Fly   460 VVSAVEFPPKKHFGNMNLVFVEERRQQLQIYLLNLVE------------TLPQVEACKSKAELQK 512
            .:     ||||..||.:|.|:||||.:|:.|:..|:|            :||.:.|        |
 Worm    70 FL-----PPKKRLGNKDLEFIEERRLELEKYVRALLELEVWYQKQKNVHSLPLITA--------K 121

  Fly   513 VFPF 516
            .|.|
 Worm   122 FFDF 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5439NP_609607.1 RUN 64..206 CDD:280855
PX_RUN 404..520 CDD:132810 38/127 (30%)
nish-1NP_502016.2 PX_domain 18..137 CDD:383026 37/126 (29%)
LRR <289..423 CDD:227223
leucine-rich repeat 291..313 CDD:275380
leucine-rich repeat 314..336 CDD:275380
leucine-rich repeat 337..359 CDD:275380
leucine-rich repeat 360..381 CDD:275380
leucine-rich repeat 382..406 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.