DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5439 and Sgk3

DIOPT Version :10

Sequence 1:NP_609607.1 Gene:CG5439 / 34710 FlyBaseID:FBgn0032476 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001362972.1 Gene:Sgk3 / 171498 RGDID:620242 Length:496 Species:Rattus norvegicus


Alignment Length:72 Identity:28/72 - (38%)
Similarity:45/72 - (62%) Gaps:4/72 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   425 YEVHITMRQRLEHWTFFRRYSEFYKLHKSLLKTHPVVSAVEFPPKKHFG-NMNLVFVEERRQQLQ 488
            |:|.:::.:  ..|..||||:||.||:.||.|..|.: |::.|.|:.|| |.:..|:::||..|.
  Rat    34 YKVLVSVGR--SEWFVFRRYAEFDKLYNSLKKQFPAM-ALKIPAKRIFGDNFDPDFIKQRRAGLN 95

  Fly   489 IYLLNLV 495
            .::.|||
  Rat    96 EFIQNLV 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5439NP_609607.1 RUN 37..206 CDD:459241
PX_RUN 404..520 CDD:132810 28/72 (39%)
Sgk3NP_001362972.1 PX_CISK 12..120 CDD:132780 28/72 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..157
STKc_SGK3 165..490 CDD:270755
Nuclear localization signal. /evidence=ECO:0000250 195..205
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.