DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5439 and RUNDC3B

DIOPT Version :9

Sequence 1:NP_609607.1 Gene:CG5439 / 34710 FlyBaseID:FBgn0032476 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_612147.1 Gene:RUNDC3B / 154661 HGNCID:30286 Length:473 Species:Homo sapiens


Alignment Length:502 Identity:94/502 - (18%)
Similarity:190/502 - (37%) Gaps:127/502 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 KFSGKELATER-----DESVQE---LCESLEELMSYGLRQSAGTSSFSAASFIQNMQEMVSGNAG 104
            :||.|.|....     |:|..|   ....||:::|:.|::.:     .:..::.::|..:.|...
Human    41 RFSVKTLIDRSCFETIDDSSPEFNNFAAILEQILSHRLKEIS-----QSCRWLAHLQIPLQGQVT 100

  Fly   105 GGSNNNDATFWEFCQTHLTPHERQ---RYMDLKQIWTNVGRGRAFIRATLNEKRLHSHVLTWLSD 166
            .....:..:||::.:.......:.   ...:::.:.::..:|||:||..|.||.|..::.|.|.|
Human   101 WFGYESPRSFWDYIRVACRKVSQNCICSIENMENVSSSRAKGRAWIRVALMEKHLSEYISTALRD 165

  Fly   167 EEQLHRFYTPWSLLLNDEAAKKLPEIVDSLSDVLFALN-VDTTELNAPRRSTPSVAVKEE----- 225
            .:...|||...:::|.:||        :.|:.:|..|| :|.           |..:|.|     
Human   166 FKTTRRFYEDGAIVLGEEA--------NMLAGMLLGLNAIDF-----------SFCLKGEGLDGS 211

  Fly   226 -PIIFTTSPVPVVGRQKRPGIAVERPIECVSSTEDLLGALKPIESVEVQQILSKESIEQELAQPQ 289
             |.:...:|.                ::.:.|::.:        |.:.:::.:..|...|.:.|:
Human   212 FPAVIDYTPY----------------LKYIQSSDSI--------SSDEEELRTLGSSGSESSTPE 252

  Fly   290 EEVNLGPFDPIEPELEFLKTPLPDIGAHVGESELYEDRSDTSSQWSKSSSSANCLANSQQQAALE 354
               |:||        .||                    .|.:|.::|      |....|:.....
Human   253 ---NVGP--------PFL--------------------MDENSWFNK------CKRVKQKYQLTL 280

  Fly   355 EHVNQLNERCALLETRVAELSLQNRLLIRR-----LTKQFEETGIDPSSSLCSNFLITIPHVKLA 414
            |....|.|...|.|.:::|...||::|::|     |..:.|:..::.......:.|..:.:..|.
Human   281 EQKGYLEELLRLRENQLSESVSQNKILLQRIEDSDLAHKLEKEQLEYIIVELQDQLTVLKNNDLR 345

  Fly   415 KTQRSGSHYT--------YEVHITMRQRLEHWTFFRRYSE--FYKLHKSL--LKTHPVVSAVEFP 467
            ..|...:|.|        .:|:......|    .:|::::  :.|.::||  |.....:|.....
Human   346 SRQELTAHLTNQWPSPGALDVNAVALDTL----LYRKHNKQWYEKSYQSLDQLSAEVSLSQTSLD 406

  Fly   468 P---KKHFGNMNLVFVEERRQQLQIYLLNLVETLPQVEACKSKAELQ 511
            |   ::..|..:.:.|....::....||.|..:|..|.:.||...|:
Human   407 PGQSQEGDGKQDTLNVMSEGKEDTPSLLGLCGSLTSVASYKSLTSLK 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5439NP_609607.1 RUN 64..206 CDD:280855 31/148 (21%)
PX_RUN 404..520 CDD:132810 24/123 (20%)
RUNDC3BNP_612147.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
RUN 65..203 CDD:397055 32/161 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 399..428 4/28 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4381
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.