DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5439 and Snx21

DIOPT Version :10

Sequence 1:NP_609607.1 Gene:CG5439 / 34710 FlyBaseID:FBgn0032476 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_061518866.1 Gene:Snx21 / 1280048 VectorBaseID:AGAMI1_014177 Length:329 Species:Anopheles gambiae


Alignment Length:61 Identity:21/61 - (34%)
Similarity:32/61 - (52%) Gaps:2/61 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   442 RRYSEFYKLHKSLLKTHPV-VSAVEFPPKKHFGNMNLVFVEERRQQLQIYLLNLVETLPQV 501
            |||:.|.||::.|.|..|. :..|.||.|...||.....:.||....:.:|.::| |:|.:
Mosquito   119 RRYTHFLKLYEGLRKDQPAQLQTVCFPKKVLMGNFTAELIGERSAAFECFLDHIV-TVPSL 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5439NP_609607.1 RUN 37..206 CDD:459241
PX_RUN 404..520 CDD:132810 21/61 (34%)
Snx21XP_061518866.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.