DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5439 and LOC1274878

DIOPT Version :10

Sequence 1:NP_609607.1 Gene:CG5439 / 34710 FlyBaseID:FBgn0032476 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_061498552.1 Gene:LOC1274878 / 1274878 VectorBaseID:AGAMI1_014636 Length:674 Species:Anopheles gambiae


Alignment Length:85 Identity:20/85 - (23%)
Similarity:37/85 - (43%) Gaps:14/85 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 YQGFASGDVDKDA---LAVREFLRDG---HQIALAQSFAKNMGL-YGERAGAFSLVTGSKDEADR 303
            ||.|..||:..:|   |.|....::.   |.|||..:....:.: |.:|....::  .:.|..:.
Mosquito   180 YQNFIEGDLTIEAFRHLEVEPMYKESDHIHIIALCTALGAGVRVEYLDRGEGGTV--KAHDFPEG 242

  Fly   304 TMSQIKILIRP-----MYSN 318
            :..:|.::.||     :|.|
Mosquito   243 SEPRIYLIYRPGHYDILYPN 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5439NP_609607.1 RUN 37..206 CDD:459241
PX_RUN 404..520 CDD:132810
LOC1274878XP_061498552.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.