DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5439 and RUNDC3A

DIOPT Version :9

Sequence 1:NP_609607.1 Gene:CG5439 / 34710 FlyBaseID:FBgn0032476 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_016879524.1 Gene:RUNDC3A / 10900 HGNCID:16984 Length:474 Species:Homo sapiens


Alignment Length:455 Identity:105/455 - (23%)
Similarity:169/455 - (37%) Gaps:109/455 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 SQKFSGKELATERDESVQELCESLEELMSYGLRQSAGTSSFSAASFIQNMQEMVS---------G 101
            |:|.|.:.:|.||...:.....|::.|:.....:....||....:|...:::::|         |
Human    16 SKKASSRNVAVERKNLITVCRFSVKTLLEKYTAEPIDDSSEEFVNFAAILEQILSHRFKACAPAG 80

  Fly   102 NAGGGSNNNDATFWEF-----------CQTHLTPHERQRYMDLKQIWTNVGRGRAFIRATLNEKR 155
            .....|::....||::           |.:.:.        :::.|.|...:|||:||..|.|||
Human    81 PVSWFSSDGQRGFWDYIRLACSKVPNNCVSSIE--------NMENISTARAKGRAWIRVALMEKR 137

  Fly   156 LHSHVLTWLSDEEQLHRFYTPWSLLLNDEAA------------------------KKLPEIVDSL 196
            :..::.|.|.|.....|||...:::|.|||.                        .|.|.::|..
Human   138 MSEYITTALRDTRTTRRFYDSGAIMLRDEATILTGMLIGLSAIDFSFCLKGEVLDGKTPVVIDYT 202

  Fly   197 SDVLFALN----VDTTELNAPRRSTPSVAVKEEPIIFTTSPVPVVG------------RQKRPGI 245
            ..:.|..:    .|..|.::...||......|.|.:      |:|.            .||...:
Human   203 PYLKFTQSYDYLTDEEERHSAESSTSEDNSPEHPYL------PLVTDEDSWYSKWHKMEQKFRIV 261

  Fly   246 AVERPI--ECVSSTEDLLGALK--------PIESVEVQQILSKESIEQELAQPQEEV-NLGPFD- 298
            ..::..  |.|...|..|..|:        .:|....|....|..:|..:.:.||:: .|.|.| 
Human   262 YAQKGYLEELVRLRESQLKDLEAENRRLQLQLEEAAAQNQREKRELEGVILELQEQLTGLIPSDH 326

  Fly   299 -PIEPELEFLKTPL----PDIGAHVG-----ESELYEDRSDTSSQWSKSSSSANCLANSQQQAAL 353
             |:....:.|.|||    |.:|...|     .|:||...|..|::  ..|:.|:..::||:   |
Human   327 APLAQGSKELTTPLVNQWPSLGTLNGAEGASNSKLYRRHSFMSTE--PLSAEASLSSDSQR---L 386

  Fly   354 EEHVNQLNERCALLET--RVAELSLQNRLLIRRLTKQFEE-TGIDPSSS---LCSNFLITIPHVK 412
            .|.... .|....:||  |.|.|.|........|..|... ||.||:.|   ||.: |.:||..|
Human   387 GEGTRD-EEPWGPIETEFRQAGLELLTSSDSPTLASQSAGITGKDPTPSMLGLCGS-LASIPSCK 449

  Fly   413  412
            Human   450  449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5439NP_609607.1 RUN 64..206 CDD:280855 36/189 (19%)
PX_RUN 404..520 CDD:132810 4/9 (44%)
RUNDC3AXP_016879524.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4381
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.