DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5439 and Snx25

DIOPT Version :9

Sequence 1:NP_609607.1 Gene:CG5439 / 34710 FlyBaseID:FBgn0032476 Length:520 Species:Drosophila melanogaster
Sequence 2:NP_001359271.1 Gene:Snx25 / 102141 MGIID:2142610 Length:986 Species:Mus musculus


Alignment Length:413 Identity:86/413 - (20%)
Similarity:152/413 - (36%) Gaps:112/413 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 ERQRYMDLKQIWTNVGRGRAFIRATLNE--KRLHSHVLT--WLSDEEQLHRFYTPWSLLLNDEAA 186
            :.|:.:..:.|.||     .|.|.....  :|:....|.  |.|.|.            |.:...
Mouse   427 QSQKILQFEDIMTN-----PFYRERFGTYMERIDKRALVGFWESAEH------------LKNANK 474

  Fly   187 KKLPEIVDSLSDVLFALNVDTTELNAPRRSTPSVAVKEEPIIFTTSPVPVVGRQKRPGIAVERPI 251
            .::|::|..:....|   |::.|::.            |..::......:||         .|.|
Mouse   475 SEIPQLVSEMYQNFF---VESKEISV------------EKSLYKEIQQCLVG---------NRGI 515

  Fly   252 ECVSSTEDLLGALKPIESVEVQQILSK--------ESIEQELAQPQEEVNLGPFDPIEPELEFLK 308
            |..|..:           .:|.::|.:        ..:.::|.:.:||.        ||:.: |.
Mouse   516 EVFSKIQ-----------ADVSEVLRERYYPSFLVSDLYEKLMREEEEE--------EPDAQ-LA 560

  Fly   309 TPLPDIGA--HVGESELYEDRSDTSSQWS-----------KSSSSANCLANSQQQAALEEH-VNQ 359
            :...::|:  ..|| |..|..|..|...|           |.......|::.|.....::. :::
Mouse   561 SEKDELGSGGEAGE-EAVEGTSGVSDPASFAVIKLRELNEKLEYKRQALSSIQNAPKPDKKIISK 624

  Fly   360 LNERCALLETRVAELSLQNRLLIRRLTKQFEETGIDPSSSLCSNFLITIPHVKLAKTQRSGSHY- 423
            |.:...|:|.....|.|.    :.|.....|..|:..:|       ||...|    |:.:|... 
Mouse   625 LKDEILLIEKECTALQLH----MARTDWWCENLGLWRAS-------ITSAEV----TEENGEQMP 674

  Fly   424 TYEVHITMRQ----RLEHWTFFRRYSEFYKLHKSLLKTHPVVSAVEFP--PKKHFGNMNLVFVEE 482
            .|.|.:.:::    ..::||..||.|||..||:.|.:..|.:..|:.|  .|..|.:::..|:.:
Mouse   675 CYFVRVNLQEVGGVETKNWTVPRRLSEFQNLHRKLSECVPSLKKVQLPSLSKLPFKSIDHKFLGK 739

  Fly   483 RRQQLQIYLLNLV--ETLPQVEA 503
            .|.||..:|.||:  |.|.|.||
Mouse   740 SRNQLNAFLQNLLSDERLFQSEA 762

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5439NP_609607.1 RUN 64..206 CDD:280855 15/83 (18%)
PX_RUN 404..520 CDD:132810 34/109 (31%)
Snx25NP_001359271.1 PXA 148..303 CDD:366970
RGS 437..545 CDD:383028 25/159 (16%)
End3 <558..645 CDD:372297 17/92 (18%)
PX_SNX25 648..770 CDD:132788 37/126 (29%)
Nexin_C 847..950 CDD:370015
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.