powered by:
Protein Alignment CG5439 and CG42814
DIOPT Version :9
Sequence 1: | NP_609607.1 |
Gene: | CG5439 / 34710 |
FlyBaseID: | FBgn0032476 |
Length: | 520 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001189301.1 |
Gene: | CG42814 / 10178958 |
FlyBaseID: | FBgn0261996 |
Length: | 237 |
Species: | Drosophila melanogaster |
Alignment Length: | 61 |
Identity: | 21/61 - (34%) |
Similarity: | 28/61 - (45%) |
Gaps: | 8/61 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 52 KELATERDESVQELC------ESLEELMSYGLRQSAGTSSFSAASFIQNMQEMVSGNAGGG 106
|.||....|.|.|.| |||:.:..| |...||||.:.:.|...:.:....:||||
Fly 130 KSLAEIAKEEVLEECGYEVPTESLQHVYDY--RSGIGTSSSAMSLFYCEVCDAQKVSAGGG 188
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG5439 | NP_609607.1 |
RUN |
64..206 |
CDD:280855 |
16/49 (33%) |
PX_RUN |
404..520 |
CDD:132810 |
|
CG42814 | NP_001189301.1 |
ADPRase_NUDT5 |
65..230 |
CDD:239516 |
21/61 (34%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4381 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.