DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG5439 and Snx21

DIOPT Version :9

Sequence 1:	NP_609607.1	Gene:	CG5439 / 34710	FlyBaseID:	FBgn0032476	Length:	520	Species:	Drosophila melanogaster
Sequence 2:	XP_030102304.1	Gene:	Snx21 / 101113	MGIID:	1917729	Length:	372	Species:	Mus musculus

Alignment Length:	143	Identity:	34/143 - (23%)
Similarity:	60/143 - (41%)	Gaps:	22/143 - (15%)

- Green bases have known domain annotations that are detailed below.

  Fly   377 QNRLLIRRLTKQFEETGI----DPSSSLCSNFLITIPHVKLAKTQRSGSHYTYEVHITMRQRLEH 437
            :|.|:.:||.  ||.|..    ||.|...:..:...|.:........|........|:
Mouse   113 RNTLVPQRLL--FEVTSANVVKDPPSKYVAWVISEEPQLYTLAVMGPGPPDRQPAQIS------- 168

  Fly   438 WTFFRRYSEFYKLHKSLLKT-HPVVSAVEFPPKKHFGNMNLVFVEERRQQLQIYLLNLVETLPQV 501
                ||||:|.:||::|.:. ...:||:.||.|:...|.....:..|.:..:.:|.:| :.:|::
Mouse   169 ----RRYSDFERLHRNLQRQFRGPMSAISFPRKRLRRNFTAETIARRSRAFEQFLGHL-QAVPEL 228

  Fly   502 EACKSKAELQKVF 514
               :...:||..|
Mouse   229 ---RQAPDLQDFF 238

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG5439	NP_609607.1	RUN	64..206	CDD:280855
CG5439	NP_609607.1	PX_RUN	404..520	CDD:132810	24/112 (21%)
Snx21	XP_030102304.1	PX_domain	121..241	CDD:383026	31/135 (23%)
		TPR_12	243..312	CDD:315987
		TPR repeat	243..267	CDD:276809
		TPR repeat	280..311	CDD:276809
		TPR repeat	325..352	CDD:276809
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG2101
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900