DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5439 and rundc3aa

DIOPT Version :9

Sequence 1:NP_609607.1 Gene:CG5439 / 34710 FlyBaseID:FBgn0032476 Length:520 Species:Drosophila melanogaster
Sequence 2:XP_001922267.3 Gene:rundc3aa / 100148117 ZFINID:ZDB-GENE-130530-533 Length:424 Species:Danio rerio


Alignment Length:501 Identity:108/501 - (21%)
Similarity:190/501 - (37%) Gaps:137/501 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 SQKFSGKELATERDESVQELCESLEELMSYGLRQSAGTSSFSAASFIQNMQEMVS----GNAGGG 106
            |:|.|.:.:..||...:.....|::.|:.....:....||....:|...::.::|    |..|..
Zfish     7 SKKTSSRNIGVERKNLITVCRFSVKTLLEKYTAEPIDDSSEEFINFAAILEHILSHRFKGPGGWF 71

  Fly   107 SNNNDATFWEF-----------CQTHLTPHERQRYMDLKQIWTNVGRGRAFIRATLNEKRLHSHV 160
            |::...:||::           |.:.:.        .::.|.|:..:|||:||..|.||||..:|
Zfish    72 SSDGQRSFWDYIRLACSKVYNNCISSIE--------SIENISTSRAKGRAWIRVALMEKRLSEYV 128

  Fly   161 LTWLSDEEQLHRFYTPWSLLLNDEAAKKLPEIVDSLSDVLFALNVDTTELNAPRRSTPSVAVKEE 225
            ...|.|.....|||...:::|.:||. .|..::..||.:.|:..:....|:.   .||:|     
Zfish   129 AIALRDTRTTRRFYDDGAVMLREEAT-VLTGMLIGLSAIDFSFCLKGEVLDG---KTPAV----- 184

  Fly   226 PIIFTTSPVPVVGRQKRPGIAVERPIECVSSTEDLLGALKPIESVEVQQILSKESIEQELAQPQE 290
             |.:|            |.:...:..:.:|..||                  :.|::...:  .|
Zfish   185 -IDYT------------PYLKFTQSYDYLSDEED------------------RRSVDSSAS--DE 216

  Fly   291 EVNLGPFDPIEPELEFLKTPLPDIGAHVGESELYEDRSDTSSQWSKSSSSANCLANSQQQAALEE 355
            .|...|:.|:                 |.:.|.:.::.....|..|       :.|: |:..|||
Zfish   217 SVAEHPYIPL-----------------VTDEETWSNKCRKMEQRFK-------IVNA-QKGYLEE 256

  Fly   356 HV----NQL------NERCALLETRVAELSLQNR-------LLIRRLTKQFEETGIDP--SSSLC 401
            .|    :||      |:|   |:.::.||.:|::       .:|..|..|.  |||.|  .|.|.
Zfish   257 LVRLRESQLKNVETENKR---LDAKLEELQVQSQQEKKELEAIILELQAQI--TGIIPCEPSHLV 316

  Fly   402 SNFLITIPHV-KLAKTQRSGSHYTYEVHITMRQRLEHWTFFRRYSEFYKLHKSLLKTHPVVSAVE 465
            ..  ::||.: :.|..|.:.:....::             |||.| |:.|..|      ...::.
Zfish   317 KG--LSIPLINQWATAQATNNQGNVKL-------------FRRRS-FHSLDLS------ADLSLN 359

  Fly   466 FPPKKHFGNMNLVFVEERRQQLQIYLLNLVETLPQVEACKSKAELQ 511
            ...:|..||.|...|....:.....:|.|..:|..:.:|||.|.|:
Zfish   360 SDSQKEDGNQNGDTVWSAAKDNTPSMLGLCGSLASLPSCKSLASLK 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5439NP_609607.1 RUN 64..206 CDD:280855 37/156 (24%)
PX_RUN 404..520 CDD:132810 24/109 (22%)
rundc3aaXP_001922267.3 RUN 51..174 CDD:280855 33/131 (25%)
Prefoldin 241..>301 CDD:298833 17/70 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4381
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.