DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfmbt and Samd13

DIOPT Version :9

Sequence 1:NP_001137821.1 Gene:Sfmbt / 34709 FlyBaseID:FBgn0032475 Length:1243 Species:Drosophila melanogaster
Sequence 2:NP_083420.2 Gene:Samd13 / 75015 MGIID:2686498 Length:234 Species:Mus musculus


Alignment Length:278 Identity:53/278 - (19%)
Similarity:89/278 - (32%) Gaps:103/278 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   967 LVN-HKLEGPPRVA---------HQQAPKPAPKPKIQRKRKPKKGAAGGKTPTDNNTQSVKSRTI 1021
            :|| :|:.|.||.|         ||.|.:..|                .|.|.|......|.:.:
Mouse     1 MVNYYKVLGVPRNASSSDIKRAFHQLALQVHP----------------DKNPGDKEAAEEKFKQV 49

  Fly  1022 ALKTTPHLPKLSIKLELKPEHHNAAFYENNQPEEEGDEEDPDADGDGDGSTSHISE--------- 1077
            |  ...|:    :....|.:.::.:.:..|:.|..|       ||...|.|..:::         
Mouse    50 A--EAYHI----LSDAKKRKDYDRSRWNRNKGEIRG-------DGHDKGETIRVNDSRDETDWEE 101

  Fly  1078 -----------QSTTQSSSDLIAGSGSGSGSASLVTLATGSNKTVKKSTTKSPAPPT-----VGR 1126
                       |..|: ..||.:|....||.      .|||.:......|.:|...|     |..
Mouse   102 KICSRRPRHTFQKVTE-DEDLFSGDCLFSGP------ITGSRRASSPFFTVTPIMDTGFSTFVSH 159

  Fly  1127 KATSYIANSSATNNKYIPRLADIDSSEPHLELVPDTWNVYDVSQFLRVNDCTAHCDTFSRNKIDG 1191
            ::.||    |.....::|.::.                  .:.:|..|..|:        ..::|
Mouse   160 ESRSY----SDDPETFVPYISQ------------------GMGKFRLVTTCS--------KTVNG 194

  Fly  1192 KRLLQLTKDDIMPLLGMK 1209
            ||:  :||..:..:.|.|
Mouse   195 KRV--VTKRVVENIRGPK 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SfmbtNP_001137821.1 MBT 542..647 CDD:214723
MBT 658..753 CDD:214723
MBT 767..871 CDD:214723
MBT 882..975 CDD:214723 3/8 (38%)
TonB_N <975..1040 CDD:292650 13/73 (18%)
SAM_Scm-like-4MBT 1160..1226 CDD:188979 10/50 (20%)
SAM 1160..1224 CDD:197735 10/50 (20%)
Samd13NP_083420.2 DnaJ 2..>67 CDD:223560 18/86 (21%)
DnaJ 3..66 CDD:278647 17/84 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839853
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.