DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfmbt and THAP10

DIOPT Version :9

Sequence 1:NP_001137821.1 Gene:Sfmbt / 34709 FlyBaseID:FBgn0032475 Length:1243 Species:Drosophila melanogaster
Sequence 2:NP_064532.1 Gene:THAP10 / 56906 HGNCID:23193 Length:257 Species:Homo sapiens


Alignment Length:92 Identity:21/92 - (22%)
Similarity:33/92 - (35%) Gaps:15/92 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   322 PIQKDGMAVCK--RCGAIGVKHTFYTKSRRFCSMACARGELYSLVLNTKMEGDQATTSSPDPGAG 384
            |:.|......|  |..::|::.......:|.|:......||:|           .|:|..|..:.
Human   175 PVHKSTQISLKRPRHRSVGIQAKVKAFGKRLCNATTQTEELWS-----------RTSSLFDIYSS 228

  Fly   385 SESADLPGDQQQSQSDIELDLHAAHIK 411
            ....|...|.:..|||  |...|..:|
Human   229 DSETDTDWDIKSEQSD--LSYMAVQVK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SfmbtNP_001137821.1 MBT 542..647 CDD:214723
MBT 658..753 CDD:214723
MBT 767..871 CDD:214723
MBT 882..975 CDD:214723
TonB_N <975..1040 CDD:292650
SAM_Scm-like-4MBT 1160..1226 CDD:188979
SAM 1160..1224 CDD:197735
THAP10NP_064532.1 THAP 4..90 CDD:214951
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 154..178 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149817
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.