DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfmbt and samd7

DIOPT Version :9

Sequence 1:NP_001137821.1 Gene:Sfmbt / 34709 FlyBaseID:FBgn0032475 Length:1243 Species:Drosophila melanogaster
Sequence 2:XP_005171361.1 Gene:samd7 / 563729 ZFINID:ZDB-GENE-070912-549 Length:527 Species:Danio rerio


Alignment Length:269 Identity:59/269 - (21%)
Similarity:99/269 - (36%) Gaps:88/269 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly  1008 PTDNNTQSVKSRTIALKTTPH--------LPKLSIKLELKPEHHNAAFYENNQPEEEGDEEDPDA 1064
            |..:..|..:.|....:||.|        |||                   .|.||:..|:.|.|
Zfish   218 PPISTLQRERGRRTGRRTTNHKSSDSNITLPK-------------------GQSEEKNIEQSPGA 263

  Fly  1065 ------DGDGDGSTSHISEQSTTQSSSDLIAGSGSGSGSASLVTLATGSNKTVKKSTTKSPAPPT 1123
                  :.:|.||.:..|:...|::.::|.:|               ||.|..|:..........
Zfish   264 ASGEEKEAEGKGSDATSSKPHQTKAETELSSG---------------GSRKGFKEGEPGIRKACI 313

  Fly  1124 VGRKATSYIAN-------------SSATNNKYI-PRLADIDSSEPHLELVPDT------------ 1162
            .|::..:.::|             .||..:|:: |..:...:..|::..||..            
Zfish   314 SGQEGCAEVSNCNASTSDKDMSNPCSAFQDKFLYPSTSGPLTGMPYMLPVPGNGLLPLGPPNMFL 378

  Fly  1163 -------------WNVYDVSQFL-RVNDCTAHCDTFSRNKIDGKRLLQLTKDDIMPLLGMKVGPA 1213
                         |.|.||..|: .:..|..:..||..:.|||:.|..||:|.::..||:|:|||
Zfish   379 NGEEMSSSEDIRKWTVDDVYSFISEIPSCAEYAQTFKEHMIDGETLPLLTEDHLLDTLGLKLGPA 443

  Fly  1214 LKISDLIAQ 1222
            |||...:::
Zfish   444 LKIRSQLSR 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SfmbtNP_001137821.1 MBT 542..647 CDD:214723
MBT 658..753 CDD:214723
MBT 767..871 CDD:214723
MBT 882..975 CDD:214723
TonB_N <975..1040 CDD:292650 9/39 (23%)
SAM_Scm-like-4MBT 1160..1226 CDD:188979 25/89 (28%)
SAM 1160..1224 CDD:197735 25/89 (28%)
samd7XP_005171361.1 SAM_Samd7,11 389..456 CDD:188978 24/64 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583944
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.