DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfmbt and SAMD7

DIOPT Version :9

Sequence 1:NP_001137821.1 Gene:Sfmbt / 34709 FlyBaseID:FBgn0032475 Length:1243 Species:Drosophila melanogaster
Sequence 2:NP_001291295.1 Gene:SAMD7 / 344658 HGNCID:25394 Length:446 Species:Homo sapiens


Alignment Length:276 Identity:63/276 - (22%)
Similarity:104/276 - (37%) Gaps:73/276 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   972 LEGPPRVAHQQAPKPAPKPKI-----QRKRKPKKGAAGGKTPTDNNTQSVKSRTIALKTTPHLPK 1031
            |:|.|.:|       |..|..     ||.|:.:|. .|.:...|::.:|.||:.           
Human   160 LQGNPMLA-------ATAPHFEESWGQRCRRLRKN-TGNQKALDSDAESSKSQA----------- 205

  Fly  1032 LSIKLELKPEHHNAAFYENNQPEEEGDEEDPDADGDGDGSTSHISEQSTT--------------- 1081
               :.::..:.|...:      ||:...:|||.:...:..:|..:|:.||               
Human   206 ---EEKILGQTHAVPY------EEDHYAKDPDIEAPSNQKSSETNEKPTTALANTCGELEPTHRK 261

  Fly  1082 ---QSSSDLIAGS-GSGSGSASLVTLATGSNKTVKKSTTKSPAPPTVGRKATSYIANSSATNNKY 1142
               ..::.|.|.: ..|...||....||...|  .......|.|...|..|...|..:.:.:.  
Human   262 PWGSHTTTLKAKAWDDGKEEASEQIFATCDEK--NGVCPPVPRPSLPGTHALVTIGGNLSLDE-- 322

  Fly  1143 IPRLADIDSSEPHLELVPDTWNVYDVSQFLR-VNDCTAHCDTFSRNKIDGKRLLQLTKDDIMPLL 1206
                 ||..           |.|.||..|:| :..|:.:...|..:.|||:.|..||::.:...:
Human   323 -----DIQK-----------WTVDDVHSFIRSLPGCSDYAQVFKDHAIDGETLPLLTEEHLRGTM 371

  Fly  1207 GMKVGPALKISDLIAQ 1222
            |:|:||||||...::|
Human   372 GLKLGPALKIQSQVSQ 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SfmbtNP_001137821.1 MBT 542..647 CDD:214723
MBT 658..753 CDD:214723
MBT 767..871 CDD:214723
MBT 882..975 CDD:214723 1/2 (50%)
TonB_N <975..1040 CDD:292650 13/69 (19%)
SAM_Scm-like-4MBT 1160..1226 CDD:188979 23/64 (36%)
SAM 1160..1224 CDD:197735 23/64 (36%)
SAMD7NP_001291295.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..207 5/34 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 225..277 9/51 (18%)
SAM_Samd7,11 324..391 CDD:188978 24/75 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149796
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.