DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfmbt and Phc1

DIOPT Version :9

Sequence 1:NP_001137821.1 Gene:Sfmbt / 34709 FlyBaseID:FBgn0032475 Length:1243 Species:Drosophila melanogaster
Sequence 2:XP_006237362.1 Gene:Phc1 / 312690 RGDID:1309203 Length:1045 Species:Rattus norvegicus


Alignment Length:164 Identity:42/164 - (25%)
Similarity:73/164 - (44%) Gaps:16/164 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly  1069 DGSTSHISEQSTTQSSSDLIAGSGSGSGSASLVTLATGSNKTV--KKSTTKSPAPPTV----GRK 1127
            :.|.:.:..:...:||||:......|.........:.||:.:.  :..:..||.|.:|    |.:
  Rat   888 EASYARVRRRGPRRSSSDIARAKIQGKRHRGQEDSSRGSDNSSYDEALSPTSPGPLSVRAGHGER 952

  Fly  1128 ATSYIANSSATNNKYIPRLADIDSSEP-HLELVPDTWNVYDVSQFL-RVNDCTAHCDTFSRNKID 1190
            .   :.|:..|     |...::....| .|...|..|:|.:|.:|: .:..|....:.|...:||
  Rat   953 D---LGNTITT-----PSTPELQGINPVFLSSNPSQWSVEEVYEFIASLQGCQEIAEEFRSQEID 1009

  Fly  1191 GKRLLQLTKDDIMPLLGMKVGPALKISDLIAQLK 1224
            |:.||.|.::.:|..:.:|:||||||...|..||
  Rat  1010 GQALLLLKEEHLMSAMNIKLGPALKICAKINVLK 1043

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SfmbtNP_001137821.1 MBT 542..647 CDD:214723
MBT 658..753 CDD:214723
MBT 767..871 CDD:214723
MBT 882..975 CDD:214723
TonB_N <975..1040 CDD:292650
SAM_Scm-like-4MBT 1160..1226 CDD:188979 24/66 (36%)
SAM 1160..1224 CDD:197735 22/64 (34%)
Phc1XP_006237362.1 zf-FCS 833..868 CDD:283998
PHC2_SAM_assoc 869..975 CDD:293222 17/94 (18%)
SAM_Ph1,2,3 976..1044 CDD:188976 24/68 (35%)
SAM 978..1045 CDD:197735 24/66 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343701
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.