DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfmbt and ph-p

DIOPT Version :9

Sequence 1:NP_001137821.1 Gene:Sfmbt / 34709 FlyBaseID:FBgn0032475 Length:1243 Species:Drosophila melanogaster
Sequence 2:NP_476871.2 Gene:ph-p / 31181 FlyBaseID:FBgn0004861 Length:1589 Species:Drosophila melanogaster


Alignment Length:291 Identity:70/291 - (24%)
Similarity:103/291 - (35%) Gaps:96/291 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   974 GPPRVAHQQAPKPAPKPKIQRK--------RKPKKGAAG---GKTP---------------TDNN 1012
            |...||.:|..|...|.|::||        |:.|.|..|   |:|.               .|..
  Fly  1359 GSDMVACEQCGKMEHKAKLKRKRYCSPGCSRQAKNGIGGVGSGETNGLGTGGIVGVDAMALVDRL 1423

  Fly  1013 TQSVKSRTIALKTTPHL----PKLSIKLELKPEHHNAAFYENNQPEEEGDEEDPDADGDGDGSTS 1073
            .:::....:..:.||.|    |.|....|:.|                                .
  Fly  1424 DEAMAEEKMQTEATPKLSESFPILGASTEVPP--------------------------------M 1456

  Fly  1074 HISEQSTTQSSSDLIAGSGSGSGSASLVTLATGSNKTVKKSTTKSPAPPTVGRKATSYIANSSAT 1138
            .:..|:...:.|.|....||.. |.:|.|||       ..|...|.|.|           .||..
  Fly  1457 SLPVQAAISAPSPLAMPLGSPL-SVALPTLA-------PLSVVTSGAAP-----------KSSEV 1502

  Fly  1139 NNKYIPRLADIDSSEPHLELVPDTWNVYDVSQFLR-VNDCTAHCDTFSRNKIDGKRLLQLTKDDI 1202
            |....|.::              :|:|.|||.|:| :..|..:.|.|.:.:|||:.||.|.:..:
  Fly  1503 NGTDRPPIS--------------SWSVDDVSNFIRELPGCQDYVDDFIQQEIDGQALLLLKEKHL 1553

  Fly  1203 MPLLGMKVGPALKISDLIAQLKCKVNPGRAR 1233
            :..:|||:||||||...:..:|....||.|:
  Fly  1554 VNAMGMKLGPALKIVAKVESIKEVPPPGEAK 1584

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
SfmbtNP_001137821.1 MBT 542..647 CDD:214723
MBT 658..753 CDD:214723
MBT 767..871 CDD:214723