DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfmbt and Scml4

DIOPT Version :9

Sequence 1:NP_001137821.1 Gene:Sfmbt / 34709 FlyBaseID:FBgn0032475 Length:1243 Species:Drosophila melanogaster
Sequence 2:XP_006256634.1 Gene:Scml4 / 309859 RGDID:1310898 Length:414 Species:Rattus norvegicus


Alignment Length:171 Identity:55/171 - (32%)
Similarity:77/171 - (45%) Gaps:29/171 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly  1071 STSHISEQSTTQSSSDLIAGSGSGSGSASLVTLATGSNKTVKKSTTKSPAP------PTVGRKAT 1129
            ||:.....|.|.|||  :......||.:.||    |...|....:..:|.|      |.:...|:
  Rat   252 STAFSHRGSVTHSSS--LYYKRLNSGDSHLV----GGPATTTSGSRTNPVPSGGSSTPGLRLPAS 310

  Fly  1130 SYIANSSA-TNNKYIPRLADIDSSEPHLELV-------PDTWNVYDVSQFLRVNDCTA---HCDT 1183
            |...|.:| ..|:..|      |..|.::..       |.||.|.||.:|::..|..|   |.:.
  Rat   311 SPKRNGTAIEGNRCAP------SPSPEIQDTRRPSSRNPSTWTVEDVVRFVKDADPQALGPHVEL 369

  Fly  1184 FSRNKIDGKRLLQLTKDDIMPLLGMKVGPALKISDLIAQLK 1224
            |.:::|||..||.|..|.||..||:|:|||||:...|.:||
  Rat   370 FRKHEIDGNALLLLRSDMIMKYLGLKLGPALKLCYHIDKLK 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SfmbtNP_001137821.1 MBT 542..647 CDD:214723
MBT 658..753 CDD:214723
MBT 767..871 CDD:214723
MBT 882..975 CDD:214723
TonB_N <975..1040 CDD:292650
SAM_Scm-like-4MBT 1160..1226 CDD:188979 31/68 (46%)
SAM 1160..1224 CDD:197735 29/66 (44%)
Scml4XP_006256634.1 RBR 1..60 CDD:407329
SLED 95..203 CDD:403384
SAM_Scm 340..411 CDD:188977 31/71 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343705
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3766
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.