DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfmbt and SCML4

DIOPT Version :9

Sequence 1:NP_001137821.1 Gene:Sfmbt / 34709 FlyBaseID:FBgn0032475 Length:1243 Species:Drosophila melanogaster
Sequence 2:XP_016866166.1 Gene:SCML4 / 256380 HGNCID:21397 Length:442 Species:Homo sapiens


Alignment Length:172 Identity:52/172 - (30%)
Similarity:73/172 - (42%) Gaps:26/172 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  1069 DGSTSHISEQSTTQSSSDLIA---GSGS---GSGSASLVTLATGSNKTVKKSTTKSPAPP----- 1122
            |.|.|..:.:.:...||.|..   .||.   |.|.|     ||.........::..|:.|     
Human   277 DTSASTFNHRGSLHPSSSLYCKRQNSGDSHLGGGPA-----ATAGGPRTSPMSSGGPSAPGLRPP 336

  Fly  1123 --TVGRKATSYIANSSATNNKYIPRLADIDSSEPHLELVPDTWNVYDVSQFLRVNDCTA---HCD 1182
              :..|..||...|..|::    |.....|:..|. ...|..|.|.||..|::..|..|   |.:
Human   337 ASSPKRNTTSLEGNRCASS----PSQDAQDARRPR-SRNPSAWTVEDVVWFVKDADPQALGPHVE 396

  Fly  1183 TFSRNKIDGKRLLQLTKDDIMPLLGMKVGPALKISDLIAQLK 1224
            .|.:::|||..||.|..|.:|..||:|:|||||:...|.:||
Human   397 LFRKHEIDGNALLLLKSDMVMKYLGLKLGPALKLCYHIDKLK 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SfmbtNP_001137821.1 MBT 542..647 CDD:214723
MBT 658..753 CDD:214723
MBT 767..871 CDD:214723
MBT 882..975 CDD:214723
TonB_N <975..1040 CDD:292650
SAM_Scm-like-4MBT 1160..1226 CDD:188979 29/68 (43%)
SAM 1160..1224 CDD:197735 27/66 (41%)
SCML4XP_016866166.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149813
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3766
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.