DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfmbt and Samd11

DIOPT Version :9

Sequence 1:NP_001137821.1 Gene:Sfmbt / 34709 FlyBaseID:FBgn0032475 Length:1243 Species:Drosophila melanogaster
Sequence 2:XP_006538909.1 Gene:Samd11 / 231004 MGIID:2446220 Length:558 Species:Mus musculus


Alignment Length:266 Identity:59/266 - (22%)
Similarity:95/266 - (35%) Gaps:91/266 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   973 EGPPRVAHQQAPKPAPKPKIQRKRKPKKGAAGGKTPTDNNTQSVKSRTIALKTTPHLPKLSIKLE 1037
            :|||      .|.|...||...:.:.:||:.|                    ..|..||      
Mouse   290 QGPP------GPGPPIPPKESARSRSEKGSLG--------------------VQPSQPK------ 322

  Fly  1038 LKPEHHNAAFYE---NNQPEEEGDEEDPD--ADGDGDGSTSHISEQSTTQSSSDLIAGS------ 1091
               |...|..:.   :.:|.::.|.|||:  |..:|..:.|.:....|......|::||      
Mouse   323 ---ETTGAGLWAQEVSEEPSKDSDGEDPETAAAREGTSTPSQVPAGGTRAEGRGLLSGSTLPPPL 384

  Fly  1092 --GSGSGSAS--LVTLATGSNKTVKKSTTKSPAPPTVGRKATSYIANSSATNNKYIPRLADIDSS 1152
              |...|:.|  ..|...|...|.:::||                             |.|::. 
Mouse   385 PLGFPCGAVSPYFHTGTMGGLFTDEETTT-----------------------------LEDVNK- 419

  Fly  1153 EPHLELVPDTWNVYDVSQFL-RVNDCTAHCDTFSRNKIDGKRLLQLTKDDIMPLLGMKVGPALKI 1216
                      |.|.||..|: .::.|..:...|....|||:.|..||::.::..:|:|:||||||
Mouse   420 ----------WTVDDVCNFVGGLSGCGEYARVFGEQGIDGETLPLLTEEHLLNTMGLKLGPALKI 474

  Fly  1217 SDLIAQ 1222
            ...:|:
Mouse   475 RAQVAK 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SfmbtNP_001137821.1 MBT 542..647 CDD:214723
MBT 658..753 CDD:214723
MBT 767..871 CDD:214723
MBT 882..975 CDD:214723 0/1 (0%)
TonB_N <975..1040 CDD:292650 12/64 (19%)
SAM_Scm-like-4MBT 1160..1226 CDD:188979 22/64 (34%)
SAM 1160..1224 CDD:197735 22/64 (34%)
Samd11XP_006538909.1 SAM_Samd7,11 417..484 CDD:188978 22/75 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839872
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.