DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Sfmbt and SAMD13

DIOPT Version :9

Sequence 1:	NP_001137821.1	Gene:	Sfmbt / 34709	FlyBaseID:	FBgn0032475	Length:	1243	Species:	Drosophila melanogaster
Sequence 2:	XP_016855866.1	Gene:	SAMD13 / 148418	HGNCID:	24582	Length:	122	Species:	Homo sapiens

Alignment Length:	81	Identity:	28/81 - (34%)
Similarity:	40/81 - (49%)	Gaps:	6/81 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly  1160 PDTWNVYDVSQFLRVNDCTAHCDTFSRNKIDGKRLLQLTKDDIMPLLGMKVGPALKISDLIAQLK 1224
            |..|.|.||..:.|..........|...:||||.||.:|::|::..|.:|:||||||.:.
Human    48 PADWAVMDVVNYFRTVGFEEQASAFQEQEIDGKSLLLMTRNDVLTGLQLKLGPALKIYEY----- 107

  Fly  1225 CKVNPGRARSHKTNKS 1240
             .|.|.:.:..|.|.|
Human   108 -HVKPLQTKHLKNNSS 122

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Sfmbt	NP_001137821.1	MBT	542..647	CDD:214723
		MBT	658..753	CDD:214723
		MBT	767..871	CDD:214723
		MBT	882..975	CDD:214723
		TonB_N	<975..1040	CDD:292650
		SAM_Scm-like-4MBT	1160..1226	CDD:188979	23/65 (35%)
		SAM	1160..1224	CDD:197735	23/63 (37%)
SAMD13	XP_016855866.1	SAM_Atherin-like	48..116	CDD:188982	25/73 (34%)
SAMD13	XP_016855866.1	SAM	48..104	CDD:197735	21/55 (38%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165149798
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.840