DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sfmbt and samd1b

DIOPT Version :9

Sequence 1:NP_001137821.1 Gene:Sfmbt / 34709 FlyBaseID:FBgn0032475 Length:1243 Species:Drosophila melanogaster
Sequence 2:XP_005163590.1 Gene:samd1b / 101884198 ZFINID:ZDB-GENE-090313-2 Length:626 Species:Danio rerio


Alignment Length:305 Identity:68/305 - (22%)
Similarity:104/305 - (34%) Gaps:89/305 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   999 KKGAAGGKTPTDNNTQSVKSRTI---------------------ALKTTPHLPK-------LSIK 1035
            :||..|.|. |.|..:.|..|.|                     |.|.:..|.|       |:.|
Zfish   304 QKGMPGEKL-TRNRVKVVLEREIERGRLRRTRLGHITLPARGMGAAKPSARLLKSALQDRHLAKK 367

  Fly  1036 LELKPEHHNAAFYENNQPEEEGDEEDPDADGDGD------GS---TSHISEQSTTQSSSDLIAGS 1091
            .|||.|.......|.|..||...|:.|:...|.|      |:   :..:..:|...:.|.::...
Zfish   368 EELKDEDGMEVESEGNGTEEPTAEDLPETVPDEDPVSVKTGTEPPSPEMEAESDHATRSPMMTCE 432

  Fly  1092 GSGSGSASL-----------VTLATGSNKTV----KKSTTKSPAPPTVGR--------------- 1126
            |....|:||           ..:.....:|:    :.|.|:.||.|:..|               
Zfish   433 GESQTSSSLQLSNHCSILQQADVGESQEQTMCAEAEDSGTEKPADPSDQRHPSVEDQMLVMSETV 497

  Fly  1127 KATSYI--------------------ANSSATNNKYIPRLADIDSSEPHLELVPDTWNVYDVSQF 1171
            |..|.|                    |:..|...:.:........||..: :.|..|.|.||:.:
Zfish   498 KPPSSIPIRNCCKLEVGVSSCLLTPSASPGAAEERGMNEGIGFVKSESSV-VSPVDWTVADVASY 561

  Fly  1172 LRVNDCTAHCDTFSRNKIDGKRLLQLTKDDIMPLLGMKVGPALKI 1216
            ............|...:||||.||.:.::|::..|.:::||||||
Zfish   562 FTAAGFPEQAIAFRTQEIDGKSLLLMQRNDVLTGLSIRLGPALKI 606

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SfmbtNP_001137821.1 MBT 542..647 CDD:214723
MBT 658..753 CDD:214723
MBT 767..871 CDD:214723
MBT 882..975 CDD:214723
TonB_N <975..1040 CDD:292650 17/68 (25%)
SAM_Scm-like-4MBT 1160..1226 CDD:188979 20/57 (35%)
SAM 1160..1224 CDD:197735 20/57 (35%)
samd1bXP_005163590.1 SAM_Atherin-like 550..618 CDD:188982 20/57 (35%)
SAM 550..617 CDD:197735 20/57 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583946
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.