Sequence 1: | NP_001137821.1 | Gene: | Sfmbt / 34709 | FlyBaseID: | FBgn0032475 | Length: | 1243 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005163590.1 | Gene: | samd1b / 101884198 | ZFINID: | ZDB-GENE-090313-2 | Length: | 626 | Species: | Danio rerio |
Alignment Length: | 305 | Identity: | 68/305 - (22%) |
---|---|---|---|
Similarity: | 104/305 - (34%) | Gaps: | 89/305 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 999 KKGAAGGKTPTDNNTQSVKSRTI---------------------ALKTTPHLPK-------LSIK 1035
Fly 1036 LELKPEHHNAAFYENNQPEEEGDEEDPDADGDGD------GS---TSHISEQSTTQSSSDLIAGS 1091
Fly 1092 GSGSGSASL-----------VTLATGSNKTV----KKSTTKSPAPPTVGR--------------- 1126
Fly 1127 KATSYI--------------------ANSSATNNKYIPRLADIDSSEPHLELVPDTWNVYDVSQF 1171
Fly 1172 LRVNDCTAHCDTFSRNKIDGKRLLQLTKDDIMPLLGMKVGPALKI 1216 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Sfmbt | NP_001137821.1 | MBT | 542..647 | CDD:214723 | |
MBT | 658..753 | CDD:214723 | |||
MBT | 767..871 | CDD:214723 | |||
MBT | 882..975 | CDD:214723 | |||
TonB_N | <975..1040 | CDD:292650 | 17/68 (25%) | ||
SAM_Scm-like-4MBT | 1160..1226 | CDD:188979 | 20/57 (35%) | ||
SAM | 1160..1224 | CDD:197735 | 20/57 (35%) | ||
samd1b | XP_005163590.1 | SAM_Atherin-like | 550..618 | CDD:188982 | 20/57 (35%) |
SAM | 550..617 | CDD:197735 | 20/57 (35%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170583946 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |