DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt1 and sirt4

DIOPT Version :9

Sequence 1:NP_477351.1 Gene:Sirt1 / 34708 FlyBaseID:FBgn0024291 Length:823 Species:Drosophila melanogaster
Sequence 2:NP_001005988.1 Gene:sirt4 / 791628 ZFINID:ZDB-GENE-041010-65 Length:310 Species:Danio rerio


Alignment Length:267 Identity:69/267 - (25%)
Similarity:106/267 - (39%) Gaps:86/267 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 NTFDDVISLVKKSQKIIVLTGAGVSVSCGIPDFRSTN-GIYAR-----LAHDFPDLPDPQAMFDI 267
            :..:.:.:.:.::.::.|::|||:|...||||:||.. |:|||     :.|              
Zfish    38 SALEQLQAFISQASRLFVISGAGLSTESGIPDYRSEGVGLYARTNRRPMQH-------------- 88

  Fly   268 NYFKRDPRPFYKFAREIYPG-----EFQPSPCHRFIKMLETKGKLLRNYTQNIDTLERVAGIQRV 327
            :.|.|..:...::....|.|     ..||:..|..::..|.||||....|||:|.|...||.||:
Zfish    89 SEFVRSEKSRQRYWARNYVGWPQFSSHQPNSAHLALRDWEEKGKLHWLVTQNVDALHLKAGQQRL 153

  Fly   328 IECHGSFSTASCTKC-----------RF----------KCNADALRADIFAQ-------RIPVCP 364
            .|.|||.....|..|           ||          .| |.|...|:|.:       |:|.|.
Zfish   154 TELHGSTHRVVCLDCGELTPRAELQKRFTALNPGWEATAC-AVAPDGDVFLEEEQVLNFRVPACN 217

  Fly   365 QCQPNKEQSVDASVAVTEEELRQLVENGIMKPDIVFFGEGLPDE----YHTVMATDKDVCDLLIV 425
            .|                        .|::||::.|||:.:...    .|..:|..    |.::|
Zfish   218 AC------------------------GGVLKPEVTFFGDVVNRNTVHFVHNKLAES----DAVLV 254

  Fly   426 IGSSLKV 432
            .||||:|
Zfish   255 AGSSLQV 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt1NP_477351.1 DUF592 <202..228 CDD:282439 1/18 (6%)
SIRT1 222..476 CDD:238699 69/254 (27%)
sirt4NP_001005988.1 SIRT4 43..304 CDD:238700 69/262 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.