DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt1 and Sirt4

DIOPT Version :9

Sequence 1:NP_477351.1 Gene:Sirt1 / 34708 FlyBaseID:FBgn0024291 Length:823 Species:Drosophila melanogaster
Sequence 2:XP_036021467.1 Gene:Sirt4 / 75387 MGIID:1922637 Length:393 Species:Mus musculus


Alignment Length:297 Identity:96/297 - (32%)
Similarity:133/297 - (44%) Gaps:68/297 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 PKRRNKLASVNTFDDVISLVKKSQKIIVLTGAGVSVSCGIPDFRSTN-GIYARLAHDFPDLPDPQ 262
            |....|:..:..|   |||   |:|::|:||||:|...||||:||.. |:|||        .|.:
Mouse    76 PLDPEKIKELQRF---ISL---SKKLLVMTGAGISTESGIPDYRSEKVGLYAR--------TDRR 126

  Fly   263 AMFDINYFKRDPRPFYKFAREI--YP--GEFQPSPCHRFIKMLETKGKLLRNYTQNIDTLERVAG 323
            .:..|::.:..|.....:||..  :|  ...||:|.|..:...|..|||....|||:|.|...||
Mouse   127 PIQHIDFVRSAPVRQRYWARNFVGWPQFSSHQPNPAHWALSNWERLGKLHWLVTQNVDALHSKAG 191

  Fly   324 IQRVIECHGSFSTASCTKC-----------RFKCNADALRADIFAQRIPVCPQCQPNKEQSVDAS 377
            .||:.|.||......|..|           ||:    ||.....|:...|.|          |..
Mouse   192 SQRLTELHGCMHRVLCLNCGEQTARRVLQERFQ----ALNPSWSAEAQGVAP----------DGD 242

  Fly   378 VAVTEEELRQLVE------NGIMKPDIVFFGEGL-PDEYHTVMATDKDVCDLLIVIGSSLKVRPV 435
            |.:|||::|....      .|.:|||:||||:.: ||:...|....|: .|.|:|:||||:|   
Mouse   243 VFLTEEQVRSFQVPCCDRCGGPLKPDVVFFGDTVNPDKVDFVHRRVKE-ADSLLVVGSSLQV--- 303

  Fly   436 AHIPSSIPATV----PQ--ILINREQLHHLKFDVELL 466
               |.|:...|    |.  ||..|||    |..:.:|
Mouse   304 ---PDSVRVAVAFAHPTGFILTAREQ----KLPIAIL 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt1NP_477351.1 DUF592 <202..228 CDD:282439 8/25 (32%)
SIRT1 222..476 CDD:238699 89/274 (32%)
Sirt4XP_036021467.1 SIRT4 85..356 CDD:238700 94/288 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.