DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt1 and SIRT6

DIOPT Version :9

Sequence 1:NP_477351.1 Gene:Sirt1 / 34708 FlyBaseID:FBgn0024291 Length:823 Species:Drosophila melanogaster
Sequence 2:NP_057623.2 Gene:SIRT6 / 51548 HGNCID:14934 Length:355 Species:Homo sapiens


Alignment Length:336 Identity:76/336 - (22%)
Similarity:132/336 - (39%) Gaps:83/336 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 ASIMPHFATGLAGDTDDSVLWDYLAHLLNEPKRRNKLASVNTFDDVISLVKKSQKIIVLTGAGVS 233
            |.:.|:...|..|          |..:.:.|:...:...     ::..||.:|..::..||||:|
Human     7 AGLSPYADKGKCG----------LPEIFDPPEELERKVW-----ELARLVWQSSSVVFHTGAGIS 56

  Fly   234 VSCGIPDFRSTNGIYAR----LAHDFPDLPDPQAMFDINYFKRDPRPFYKFAREIYPGEFQPSPC 294
            .:.||||||..:|::..    ||        |:  ||..         ::.||        |:..
Human    57 TASGIPDFRGPHGVWTMEERGLA--------PK--FDTT---------FESAR--------PTQT 94

  Fly   295 HRFIKMLETKGKLLRNYTQNIDTLERVAGIQR--VIECHGSFSTASCTKCRFKCNAD------AL 351
            |..:..||..|.|....:||:|.|...:|..|  :.|.||:.....|.||:.:...|      .|
Human    95 HMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGL 159

  Fly   352 RADIFAQRIPVCPQCQPNKEQSVDASVAVTEEELRQLVENGIMKPDIVFFGEGLPDEYHTVMATD 416
            :|   ..|:     |...|.:.:.|.             .|.::..|:.:.:.|||....:....
Human   160 KA---TGRL-----CTVAKARGLRAC-------------RGELRDTILDWEDSLPDRDLALADEA 203

  Fly   417 KDVCDLLIVIGSSLKVRPVAHIPSSIPATVPQ----ILINREQLHHLKF-DVELLGDSDVIINQI 476
            ....||.|.:|:||::||..::|.   ||..:    :::|.:...|.:. |:.:.|..|.::.::
Human   204 SRNADLSITLGTSLQIRPSGNLPL---ATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRL 265

  Fly   477 CHRLSDNDDCW 487
            ...|......|
Human   266 MKHLGLEIPAW 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt1NP_477351.1 DUF592 <202..228 CDD:282439 3/25 (12%)
SIRT1 222..476 CDD:238699 65/270 (24%)
SIRT6NP_057623.2 SIRT7 45..257 CDD:238701 63/262 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 284..355
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.