DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt1 and SIRT7

DIOPT Version :9

Sequence 1:NP_477351.1 Gene:Sirt1 / 34708 FlyBaseID:FBgn0024291 Length:823 Species:Drosophila melanogaster
Sequence 2:XP_024306560.1 Gene:SIRT7 / 51547 HGNCID:14935 Length:442 Species:Homo sapiens


Alignment Length:291 Identity:71/291 - (24%)
Similarity:105/291 - (36%) Gaps:93/291 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 DYLAHLLNEPKRRN--KLASVNTFDD----------VISLVKKSQKIIVLTGAGVSVSCGIPDFR 242
            |.:..|....:||.  |.......||          :.|.|:.::.::|.||||:|.:..|||:|
Human    56 DLVTELQGRSRRREGLKRRQEEVCDDPEELRGKVRELASAVRNAKYLVVYTGAGISTAASIPDYR 120

  Fly   243 STNGIYARL----AHDFPDLPDPQAMFDINYFKRDPRPFYKFAREIYPGEFQPSPCHRFIKMLET 303
            ..||::..|    :....||                            .|.:|:..|..|..|..
Human   121 GPNGVWTLLQKGRSVSAADL----------------------------SEAEPTLTHMSITRLHE 157

  Fly   304 KGKLLRNYTQNIDTLERVAGIQR--VIECHGSFSTASCTKCRFKCNADALRADIFAQRIPVCPQC 366
            :..:....:||.|.|...:|:.|  :.|.||:                        ..|.||..|
Human   158 QKLVQHVVSQNCDGLHLRSGLPRTAISELHGN------------------------MYIEVCTSC 198

  Fly   367 QPNKE--QSVDASVAVTEEELRQLVENG--------IMKPDIVFFGE----GLPDEYHTVMATD- 416
            .||:|  :..|    |||.......:.|        .::..||.|||    |.|..:..  ||: 
Human   199 VPNREYVRVFD----VTERTALHRHQTGRTCHKCGTQLRDTIVHFGERGTLGQPLNWEA--ATEA 257

  Fly   417 KDVCDLLIVIGSSLKVRPVAHIPSSIPATVP 447
            ....|.::.:|||||||  |....|.|:..|
Human   258 ASRADTILCLGSSLKVR--ADDTMSEPSPCP 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt1NP_477351.1 DUF592 <202..228 CDD:282439 7/37 (19%)
SIRT1 222..476 CDD:238699 62/247 (25%)
SIRT7XP_024306560.1 YscO 16..>101 CDD:284686 9/44 (20%)
SIRT7 100..356 CDD:238701 62/247 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.