DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt1 and Sirt5

DIOPT Version :9

Sequence 1:NP_477351.1 Gene:Sirt1 / 34708 FlyBaseID:FBgn0024291 Length:823 Species:Drosophila melanogaster
Sequence 2:NP_001004256.1 Gene:Sirt5 / 306840 RGDID:1303285 Length:310 Species:Rattus norvegicus


Alignment Length:288 Identity:74/288 - (25%)
Similarity:120/288 - (41%) Gaps:86/288 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 SQKIIVLTGAGVSVSCGIPDFRSTNGIYAR--LAHDFPDLPDPQAMFDINYFKRDPR---PFYKF 280
            ::.|::::|||||...|:|.||.|.|.:.:  ..|    |..|.|      |..:|.   .||.:
  Rat    50 AKHIVIISGAGVSAESGVPTFRGTGGYWRKWQAQH----LATPLA------FAHNPSQVWEFYHY 104

  Fly   281 AREIYPGEFQPSPCHRFIKMLETK----GKLLRNYTQNIDTLERVAGIQRVIECHGSFSTASCTK 341
            .||:...: :|:|.|..|...|.:    |:.:...|||||.|.|.||.:.::|.||:.....||.
  Rat   105 RREVMRNK-EPNPGHLAIAQCEARLRDQGRRVVVITQNIDELHRKAGTKNLLEIHGTLFKTRCTS 168

  Fly   342 C-----RFKCNADALRADIFAQRIPVCPQC------QPNKEQSVDASVAVTEEELRQLVE---NG 392
            |     .:|.              |:||..      :|:.::|     .:...:|.:..|   .|
  Rat   169 CGNVAENYKS--------------PICPALLGKGAPEPDTQES-----RIPVHKLPRCEEAGCGG 214

  Fly   393 IMKPDIVFFGEGLPDEYHTVMATDKDV--CDLLIVIGSSLKVRPVA------------------- 436
            :::|.:|:|||.|  :...:...|:::  |||.:|:|:|..|.|.|                   
  Rat   215 LLRPHVVWFGENL--DPAILKEVDRELARCDLCLVVGTSSVVYPAAMFAPQVASRGVPVAEFNME 277

  Fly   437 ----------HIPSSIPATVPQILINRE 454
                      |.|.....|:|:.|...|
  Rat   278 TTPATNRFRFHFPGPCGVTLPEALAPHE 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt1NP_477351.1 DUF592 <202..228 CDD:282439 1/6 (17%)
SIRT1 222..476 CDD:238699 74/287 (26%)
Sirt5NP_001004256.1 SIRT5_Af1_CobB 51..301 CDD:238703 72/281 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.