DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt1 and Sirt4

DIOPT Version :9

Sequence 1:NP_477351.1 Gene:Sirt1 / 34708 FlyBaseID:FBgn0024291 Length:823 Species:Drosophila melanogaster
Sequence 2:NP_001100617.2 Gene:Sirt4 / 304539 RGDID:1310413 Length:319 Species:Rattus norvegicus


Alignment Length:304 Identity:91/304 - (29%)
Similarity:132/304 - (43%) Gaps:76/304 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 RWLQREFYTGRVPRQVIASIMPHFATGLAGDTDDSVLWDYLAHLLNEPKRRNKLASVNTFDDVIS 216
            ||:.:           ::.:..|.:|||....             :.|....|:..:..|   ||
  Rat    20 RWITQ-----------MSQLRSHGSTGLFVPP-------------SPPLDHEKIKELQRF---IS 57

  Fly   217 LVKKSQKIIVLTGAGVSVSCGIPDFRSTN-GIYARLAHDFPDLPDPQAMFDINYFKRDPRPFYKF 280
            |   |:|::|:||||:|...||||:||.. |:|||        .|.:.:..|::.:..|.....:
  Rat    58 L---SKKLLVMTGAGISTESGIPDYRSEKVGLYAR--------TDRRPIQHIDFIRSAPVRQRYW 111

  Fly   281 AREI--YP--GEFQPSPCHRFIKMLETKGKLLRNYTQNIDTLERVAGIQRVIECHGSFSTASCTK 341
            ||..  :|  ...||:|.|..:...|..|||....|||:|.|...||.||:.|.||......|..
  Rat   112 ARNFVGWPQFSSHQPNPAHWALSNWEKLGKLHWLVTQNVDALHSKAGNQRLTELHGCMHRVLCLS 176

  Fly   342 C-----------RFKCNADALRADIFAQRIPVCPQCQPNKEQSVDASVAVTEEELRQLVE----- 390
            |           ||:    ||.....|:...|.|          |..|.:|||::|....     
  Rat   177 CGEQTARRVLQDRFQ----ALNPSWSAEAQGVAP----------DGDVFLTEEQVRSFRVPCCDR 227

  Fly   391 -NGIMKPDIVFFGEGL-PDEYHTVMATDKDVCDLLIVIGSSLKV 432
             .|.:|||:||||:.: ||:...|....|: .|.|:|:||||:|
  Rat   228 CGGPLKPDVVFFGDTVNPDKVDFVHQRVKE-ADSLLVVGSSLQV 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt1NP_477351.1 DUF592 <202..228 CDD:282439 8/25 (32%)
SIRT1 222..476 CDD:238699 78/234 (33%)
Sirt4NP_001100617.2 SIRT4 52..313 CDD:238700 83/248 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.