DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt1 and Sirt7

DIOPT Version :9

Sequence 1:NP_477351.1 Gene:Sirt1 / 34708 FlyBaseID:FBgn0024291 Length:823 Species:Drosophila melanogaster
Sequence 2:XP_008766699.1 Gene:Sirt7 / 303745 RGDID:1305876 Length:426 Species:Rattus norvegicus


Alignment Length:279 Identity:69/279 - (24%)
Similarity:108/279 - (38%) Gaps:73/279 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 DYLAHLLNEPKRRN--KLASVNTFDD----------VISLVKKSQKIIVLTGAGVSVSCGIPDFR 242
            |.:..|....:||.  |.......||          :...|:.::.::|.||||:|.:..|||:|
  Rat    57 DLVTELQGRSRRREGLKRRQEEVCDDPEELRRKVRELAGAVRSARHLVVYTGAGISTAASIPDYR 121

  Fly   243 STNGIYARLAHDFP----DLPDPQAMFDINYFKRDPRPFYKFAREIYPGEFQPSPCHRFIKMLET 303
            ..||::..|....|    ||                            .|.:|:..|..|..|. 
  Rat   122 GPNGVWTLLQKGRPVSAADL----------------------------SEAEPTLTHMSITQLH- 157

  Fly   304 KGKLLRN-YTQNIDTLERVAGIQR--VIECHGSFSTASCTKCRFKCNADALRADIFAQRIP-VCP 364
            |.||::: .:||.|.|...:|:.|  :.|.||:......:..|.:...|. :..:....:| ||.
  Rat   158 KHKLVQHVVSQNCDGLHLRSGLPRTAISELHGNMYIEVSSAQRTQGLGDK-QMSLTVPSLPQVCT 221

  Fly   365 QCQPNKEQSVDASVAVTEEELRQLVENGI-----------MKPDIVFFGE----GLPDEYHTVMA 414
            .|.||:|.     |.|.:...|..:...:           ::..||.|||    |.|..:..  |
  Rat   222 SCIPNREY-----VRVFDVTERTALHRHLTGRTCHKCGTQLRDTIVHFGERGTLGQPLNWEA--A 279

  Fly   415 TD-KDVCDLLIVIGSSLKV 432
            |: ....|.::.:||||||
  Rat   280 TEAASKADTILCLGSSLKV 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt1NP_477351.1 DUF592 <202..228 CDD:282439 6/37 (16%)
SIRT1 222..476 CDD:238699 61/235 (26%)
Sirt7XP_008766699.1 SIRT7 102..339 CDD:238701 61/234 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.