DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt1 and Sirt3

DIOPT Version :9

Sequence 1:NP_477351.1 Gene:Sirt1 / 34708 FlyBaseID:FBgn0024291 Length:823 Species:Drosophila melanogaster
Sequence 2:XP_006230588.1 Gene:Sirt3 / 293615 RGDID:1308374 Length:334 Species:Rattus norvegicus


Alignment Length:283 Identity:109/283 - (38%)
Similarity:165/283 - (58%) Gaps:41/283 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 TFDDVISLV--KKSQKIIVLTGAGVSVSCGIPDFRST-NGIYARLAHDFPDLPDPQAMFDINYFK 271
            :..||..|:  :...:::|:.|||:|...|||||||. :|:|:.|..  .|:|.|:|:|::.:|.
  Rat    59 SLQDVAELLRTRACSRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQ--YDIPYPEAIFELGFFF 121

  Fly   272 RDPRPFYKFAREIYPGEFQPSPCHRFIKMLETKGKLLRNYTQNIDTLERVAGI--QRVIECHGSF 334
            .:|:||:..|:|:|||.::|:..|.|:::|..|..|||.||||||.|||.:||  .:::|.||||
  Rat   122 HNPKPFFTLAKELYPGHYRPNVAHYFLRLLHDKELLLRLYTQNIDGLERASGIPASKLVEAHGSF 186

  Fly   335 STASCTKCRFKCNADALRADIFAQRIPVCPQCQPNKEQSVDASVAVTEEELRQLVENGIMKPDIV 399
            .:|:||.||.....:.:|||:.|.|:|.||.|                        .|::|||||
  Rat   187 VSATCTVCRRSFPGEDIRADVMADRVPRCPVC------------------------TGVVKPDIV 227

  Fly   400 FFGEGLPDEYHTVMATDKDVCDLLIVIGSSLKVRPVAHIPSSIPATVPQILINRE-----QLHHL 459
            ||||.||..: .:...|..:.|||:::|:||:|.|.|.:..|:..:||::||||:     .|...
  Rat   228 FFGEQLPARF-LLHVADFALADLLLILGTSLEVEPFASLSESVQKSVPRLLINRDLVGSFALSPR 291

  Fly   460 KFDVELLGDSDVIINQICHRLSD 482
            :.||..|||    :.|...||.|
  Rat   292 RKDVVQLGD----VVQGVERLVD 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt1NP_477351.1 DUF592 <202..228 CDD:282439 4/19 (21%)
SIRT1 222..476 CDD:238699 102/261 (39%)
Sirt3XP_006230588.1 SIRT1 74..308 CDD:238699 103/264 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D512963at33208
OrthoFinder 1 1.000 - - FOG0000643
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.