DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sirt1 and SIRT2

DIOPT Version :9

Sequence 1:NP_477351.1 Gene:Sirt1 / 34708 FlyBaseID:FBgn0024291 Length:823 Species:Drosophila melanogaster
Sequence 2:NP_036369.2 Gene:SIRT2 / 22933 HGNCID:10886 Length:389 Species:Homo sapiens


Alignment Length:363 Identity:125/363 - (34%)
Similarity:196/363 - (53%) Gaps:71/363 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 GLAGDTDDSVLWDYLAHLLNEP----KRRNKLASVNTFDDVISLV--KKSQKIIVLTGAGVSVSC 236
            |.||...|   .|:|.:|.::.    .::.:|....|.:.|...:  ::.:::|.|.|||:|.|.
Human    30 GAAGGEAD---MDFLRNLFSQTLSLGSQKERLLDELTLEGVARYMQSERCRRVICLVGAGISTSA 91

  Fly   237 GIPDFRS-TNGIYARLA--HDFPDLPDPQAMFDINYFKRDPRPFYKFAREIYPGEFQPSPCHRFI 298
            ||||||| :.|:|..|.  |    ||.|:|:|:|:|||:.|.||:..|:|:|||:|:|:.||.|:
Human    92 GIPDFRSPSTGLYDNLEKYH----LPYPEAIFEISYFKKHPEPFFALAKELYPGQFKPTICHYFM 152

  Fly   299 KMLETKGKLLRNYTQNIDTLERVAGIQR--VIECHGSFSTASC--TKCRFKCNADALRADIFAQR 359
            ::|:.||.|||.||||||||||:||:::  ::|.||:|.|:.|  ..||.:.....::..||::.
Human   153 RLLKDKGLLLRCYTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEV 217

  Fly   360 IPVCPQCQPNKEQSVDASVAVTEEELRQLVENGIMKPDIVFFGEGLPDEYHTVMATDKDVCDLLI 424
            .|.|..||                        .::|||||||||.||..:.:.|.:|....|||:
Human   218 TPKCEDCQ------------------------SLVKPDIVFFGESLPARFFSCMQSDFLKVDLLL 258

  Fly   425 VIGSSLKVRPVAHIPSSIPATVPQILINREQLHHLKFDVELLGDSDVIINQICHRLS----DNDD 485
            |:|:||:|:|.|.:.|..|.:.|::|||:|:          .|.||..:..|.....    |:..
Human   259 VMGTSLQVQPFASLISKAPLSTPRLLINKEK----------AGQSDPFLGMIMGLGGGMDFDSKK 313

  Fly   486 CWRQLC----CDESVLT---------ESKELMPPEHSN 510
            .:|.:.    ||:..|.         |.::|:..||::
Human   314 AYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHAS 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sirt1NP_477351.1 DUF592 <202..228 CDD:282439 4/27 (15%)
SIRT1 222..476 CDD:238699 105/260 (40%)
SIRT2NP_036369.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34 2/3 (67%)
Nuclear export signal 41..51 2/9 (22%)
SIRT1 77..331 CDD:238699 111/291 (38%)
Peptide inhibitor binding 116..120 1/3 (33%)
Peptide inhibitor binding 232..301 30/78 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 351..389 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0846
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D512963at33208
OrthoFinder 1 1.000 - - FOG0000643
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.